KEGG   Acanthamoeba castellanii: ACA1_374380Help
Entry
ACA1_374380       CDS       T02667                                 

Definition
(RefSeq) heat shock protein ssa1, putative
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
acan  Acanthamoeba castellanii
Pathway
acan03040  Spliceosome
acan04141  Protein processing in endoplasmic reticulum
acan04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:acan00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    ACA1_374380
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    ACA1_374380
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    ACA1_374380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acan01009]
    ACA1_374380
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:acan03041]
    ACA1_374380
   03009 Ribosome biogenesis [BR:acan03009]
    ACA1_374380
   03110 Chaperones and folding catalysts [BR:acan03110]
    ACA1_374380
   04131 Membrane trafficking [BR:acan04131]
    ACA1_374380
   03051 Proteasome [BR:acan03051]
    ACA1_374380
   03029 Mitochondrial biogenesis [BR:acan03029]
    ACA1_374380
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acan04147]
    ACA1_374380
Protein phosphatases and associated proteins [BR:acan01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     ACA1_374380
Spliceosome [BR:acan03041]
 Complex B
  Other components
   Prp19 complex
    ACA1_374380
 Complex C
   Prp19-CDC5 complex
    ACA1_374380
Ribosome biogenesis [BR:acan03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    ACA1_374380
Chaperones and folding catalysts [BR:acan03110]
 Heat shock proteins
  HSP70 / DNAK
   ACA1_374380
Membrane trafficking [BR:acan04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    ACA1_374380
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    ACA1_374380
Proteasome [BR:acan03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    ACA1_374380
Mitochondrial biogenesis [BR:acan03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    ACA1_374380
Exosome [BR:acan04147]
 Exosomal proteins
  Proteins found in most exosomes
   ACA1_374380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A Ppx-GppA Z1
Motif
Other DBs
NCBI-GeneID: 14912827
NCBI-ProteinID: XP_004334383
UniProt: L8GGZ4
Position
Unknown
AA seq 622 aa AA seqDB search
MSKYTSIGIDLGTTYSCVGVWQNDRVEIIANDQGNRVTPSYVAFTDTERLIGDAAKNQVA
MNPHNTVFDAKRLIGRNYSDPVVQADMKHWPFKVVQKPGDKPFISVEYKGERKEFSPEEI
SSMVLIKMKETAEAYLGHPVTTAVITVPAYFNDSQRQATKDAGTISGMQVKRIINEPTAA
AIAYGLNKKARGEMNVLIFDLGGGTFDVSLLTIEEGVFEVKATAGDTHLGGEDFDNRMVN
HFVHEFKRKHGKDISGNARAVRRLRTACERAKRALSSATQASIEIDSLYEGVDFYTSITR
ARFEELCADLFRATMDPVEKVLRDAKMDKRAVSEVVLVGGSTRIPKIQQLVTQFFNGKEP
CKSINPDEAVAYGAAVQAAILDGVATEGSVLNDMVLIDVAPLTLGIETAGGVFSTYEDNQ
PGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAADKTT
GKSEKITIRNDKGRLSKEEIDRMVKEAERYKADDERAKEKVEAKNALENYAYTMRNTMRD
DNVASKLAPEDKSKIEHATDDTIKWLEANQTAEKDELDYKKKELEDVCTSSAGGMPDMGG
MGGAPGARSAGSGAGPKIEEVD
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagtacacaagcattggcatcgacctgggcacgacctactcgtgcgtgggcgtg
tggcagaacgatcgggtggagatcatcgccaacgaccagggcaaccgcgtgaccccgtcc
tacgtggccttcaccgacaccgagcgcctgatcggcgacgcggccaagaaccaggtcgcg
atgaacccgcacaacaccgtgttcgacgccaagcgcctcatcggccgcaactactcggac
ccggtcgtccaggccgacatgaagcactggcccttcaaggtggtccagaagcccggcgac
aagcccttcatctcggtcgagtacaagggcgagcgcaaggagttctcgcccgaggagatc
tcgtcgatggtgctcatcaagatgaaggagacggccgaggcctacctgggccaccccgtc
accaccgccgtcatcaccgtccccgcctacttcaacgactctcagcgccaggccaccaag
gacgccggcaccatctcgggcatgcaggtcaagcgcatcatcaacgagcccaccgccgcc
gccatcgcgtacggtctcaacaagaaggctcgcggcgagatgaacgtgctcatcttcgac
ctgggcggcggcaccttcgacgtttcgctcctgaccatcgaggagggcgtgttcgaggtc
aaggccaccgccggcgacacccacctcggcggcgaggactttgacaaccgcatggtcaac
cacttcgtccatgagttcaagcgcaagcacggcaaggacatctcgggcaacgcgcgcgca
gtccgtcgactgcgcacggcctgcgagcgggccaagcgcgccctgtcgtcggcgacccag
gccagcatcgagatcgactcgctctacgagggcgtcgacttctacacttcgatcacccgc
gcccgcttcgaggagctctgcgccgacctattccgcgcgaccatggaccccgtcgagaag
gtgctgcgcgacgccaagatggacaagcgcgccgtgagcgaggtggtgctggtcggcggc
tcgacccgcattcccaagattcagcagctcgtcacccagttcttcaacggcaaggagccc
tgcaagtcgatcaaccccgacgaggctgtcgcctacggcgccgcggtgcaggccgccatc
ctggacggcgtggccacagagggctctgtgctcaacgacatggtgctgatcgacgtggcc
ccgctcaccctgggcatcgagaccgccggcggtgtcttctcgacctacgaagacaaccag
ccgggcgtgctgatccaggtctacgagggcgagcgggccatgacccgcgacaacaacctg
ctgggcaagttcgagctgtcgggcatcccgcccgctccgcgcggcgttccgcaggtcgag
gtcacgttcgacatcgacgccaacggcatcttgaacgtttccgcagcggacaagacgacc
ggcaagtcggagaagatcaccattcgcaacgacaagggccggctgtcgaaggaggagatc
gaccgcatggtgaaggaggccgagcgctacaaggccgacgacgagcgcgccaaggagaag
gtcgaggccaagaacgccctggagaactacgcctacacgatgcgcaacacgatgcgcgac
gacaacgtggcctcgaagctggcgcccgaggacaagtccaagatcgagcacgccaccgac
gacaccatcaagtggctcgaggccaaccagaccgccgagaaggacgagctcgactacaag
aagaaggagctcgaggacgtatgtaccagcagtgccggcggcatgcccgacatgggcggc
atgggcggtgctcccggggctcgttcggccgggtcgggtgccggccccaagatcgaggag
gtggactag

DBGET integrated database retrieval system