KEGG   Acanthamoeba castellanii: ACA1_381120Help
Entry
ACA1_381120       CDS       T02667                                 

Definition
(RefSeq) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00350  Tyrosine metabolism
acan01100  Metabolic pathways
Module
acan_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:acan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ACA1_381120
Enzymes [BR:acan01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     ACA1_381120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 14915006
NCBI-ProteinID: XP_004336438
UniProt: L8GMX6
Position
Unknown
AA seq 241 aa AA seqDB search
MSSDSGSGGDRPVLYSYWRSSCSYRVRIALAFKGIDYEYRAVNLAAKGGGEQHQTEYERL
NPMKAVPTLLIDGAAIGQSVAILDSLNGLEQETRPEPSLLPAAGQGATAAVQRAKVRQLV
QIICADTQPLQNSSVLAAIAGDDEEGKAAFARKWIERGLRAYEKTIETTAGRYSVGDEVT
LADLALVPQLYNARRFGIDVTTAFPALARIDEALQQLPAFRAAHPDAQIDAPASQQQGPQ
C
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgacagcggtagtggtggagacagaccggtgctgtactcgtactggcgcagc
tcatgctcgtatcgtgtccgtatagcgctcgccttcaagggcatcgattacgagtaccgg
gcggttaatcttgcggccaagggcgggggcgagcagcaccagactgagtacgagcgtctg
aaccccatgaaggccgtgcccacgctcctcatcgacggagccgccatcggtcagtccgtg
gccatcttggattcactcaacgggctcgagcaggagacgaggcccgagccttcgctgctg
ccggccgcgggccagggggcgacggcagcggtgcagcgcgccaaggtgcggcagctggtg
cagatcatctgcgccgacacgcagccgctccaaaacagctcggtgctggcggcgatcgct
ggcgatgacgaggagggtaaggccgccttcgcgcgcaagtggatcgagcgtggccttcga
gcctacgagaagaccattgagacgacggcaggtcggtacagtgtgggcgatgaggtcacc
ctggccgatctggctctggtgccacagctctacaacgcccgtcgcttcggcatcgacgtc
acgacggccttccctgctcttgcgcgcatcgacgaggccctgcagcagctgccagccttt
cgagcggcccaccccgacgctcaaatcgatgccccggcctcacaacaacaaggaccacaa
tgctga

DBGET integrated database retrieval system