KEGG   Acanthamoeba castellanii: ACA1_381510Help
Entry
ACA1_381510       CDS       T02667                                 

Definition
(RefSeq) NADH dehydrogenase, putative
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
acan  Acanthamoeba castellanii
Brite
KEGG Orthology (KO) [BR:acan00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACA1_381510
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     ACA1_381510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 14915015
NCBI-ProteinID: XP_004336447
UniProt: L8GNN7
Position
Unknown
AA seq 473 aa AA seqDB search
MRSRVTTSTARTSTSTLLAVAYRPAAHTATALPLSGPRFVRALATTTTVDGGKQRKKLVV
LGNGWAGYRLILDVDISKYELSVISPRNYFLFTPLLTSTTVGTLEFRGVIEPVRTARPGL
NYIQAGATSVDTTNKVVTFESVYEERETDEEVPVHPAASIKYDELVIAVGAAPNTFGVPG
VEKYCYFLKSVADARNIRQRIIECFERASSPTTTEAERSRLLHFVIVGGGPTSVEFSAEL
HDFLRKDVHKIYPDLEKQVQITLIEAGKTLLSTFDQRLSDYTMRTFRKRNIDVRTSVSVK
QVKRHEMVLSDGAVIPFGLGVWSTGLSPIPFIKGLPFPKDRSGRLLVDEYLHVKAPGVEG
VYAVGDCAAFETNPLPATAQGAEQEGKYLAQALNAKARGEEPKKFQYHHKGMLAYVGGYR
ALIDSPLIKRSGFLTWIMWNAAYITKLVSIKNKMMIPMYWFKSFVFGRDISRF
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcagagtcaccacgtccacagcccgcacctccacttctacgctacttgccgtg
gcgtaccgccctgccgcacacactgccaccgctctgccgctttcggggccacgatttgtg
cgtgcactcgcgaccaccacaaccgtcgacggcgggaagcagcgaaagaagctcgtggtg
ttgggcaacggctgggccggctatcgcctcatcctcgacgtcgatatcagcaagtatgag
ctcagtgtcatcagccccaggaactactttctgttcacccctctgcttacctccaccact
gtgggcacgctcgagttcagaggcgtgatcgaacccgtgcgcactgcccgccctggactc
aactacatccaagctggcgccaccagtgtggataccaccaacaaagtggtcacctttgag
agcgtgtacgaagaaagagagacagacgaagaggttccggttcatcccgccgcctcgatc
aaatacgacgagcttgtgattgccgtgggagctgcgcccaacacattcggagtgcccggc
gttgagaagtactgctacttccttaagtctgtggccgacgcccgcaacattcgacagcgg
atcatcgagtgtttcgagcgcgccagcagccccacgacaacagaggccgagcgaagccgc
cttctccactttgtcatcgtcggcggcggtcccacatcggtcgagttcagcgccgaactc
cacgatttcctgcgcaaggacgtgcacaagatctatccggatctcgagaagcaggtgcag
atcacgctcatcgaagccggcaagacgctgctgagcacgttcgaccaacgtttgagcgac
tacaccatgcgcaccttcaggaagaggaacatcgacgttcgcaccagcgtgtcggtcaag
caggtgaagcgccacgagatggtgctgtctgatggcgccgtcatccccttcggcctcggc
gtctggtccaccggcctgtcgccaatcccgttcatcaagggcctcccattccccaaggac
aggtcgggccgactgctggtcgacgagtacctgcacgtgaaggcgccgggcgtggagggc
gtgtacgcggtgggcgactgcgccgccttcgagaccaacccgctgccggccaccgcccag
ggcgccgaacaggagggcaaatatcttgcgcaggcgctgaacgcaaaggcacgaggggag
gagcccaagaagttccagtaccaccacaagggcatgctcgcgtacgtgggtggctaccgg
gcgctgatcgactcgccgctgatcaagcggtcgggcttcctcacgtggatcatgtggaac
gcggcctacatcaccaagctcgtgtccatcaagaacaagatgatgatccccatgtactgg
ttcaagtccttcgtcttcggccgcgacatctcccgattctga

DBGET integrated database retrieval system