KEGG   Aeromonas caviae: VI35_03180Help
Entry
VI35_03180        CDS       T05190                                 

Definition
(GenBank) NAD(+) diphosphatase
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
acav  Aeromonas caviae
Pathway
acav00760  Nicotinate and nicotinamide metabolism
acav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acav00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    VI35_03180
Enzymes [BR:acav01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     VI35_03180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX zf-NADH-PPase Zn_ribbon_recom
Motif
Other DBs
NCBI-ProteinID: ATP89530
Position
664781..665560
Genome map
AA seq 259 aa AA seqDB search
MSSTEQAFWFVLGGDHLVLLDEQGRIPQGPRAVLPTHLHTASFERFDEWDGLPCHLLDLG
AEAETGAMAPLRQLMVAGDEEGFRLAGRAWQLATFRRTHRFCGECGAPMTPREGEWAQGC
HHGHVVYPRISPCIIVAVRKGPAILLAAHRRHYQADDPMYTVLAGFVEAGENLEQCVARE
VFEESGIRVANVRYVASQPWPFPHSLMMGFTADYENGEIRVQDDELVAAGFFEADRLPRL
PPHGTIARRLIEQCLAEAR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaactgaacaggccttctggttcgtgctggggggcgatcacctcgtcctgctg
gatgaacaggggcgcattccacaagggccccgcgccgttttgcccacccatctgcacact
gcctccttcgagcgcttcgacgagtgggacggcctgccttgccatctgctggatctgggg
gctgaggcggagaccggggccatggccccgctgcgccagctcatggtggcgggggacgaa
gagggctttcgcctcgcaggacgggcctggcagctcgccacctttcgccgtacccatcgt
ttctgcggtgagtgcggcgcccccatgaccccgagggaaggggagtgggcccaggggtgt
catcacggccatgtcgtctatccgcgcatctccccctgcatcatcgtcgcggtgcgcaag
ggaccggccatcttgctggcagcccaccgccgtcactatcaggcggatgatcccatgtat
accgtgctggccggcttcgtggaggcaggggagaatctggagcaatgtgtggcgcgggag
gtgttcgaggagagcggcatccgggtggccaatgtgcgttacgtagcgagccagccctgg
cccttcccccacagcctgatgatgggcttcaccgccgactatgagaacggcgagatccgg
gtgcaggatgacgaactggtggcggcaggcttctttgaggctgaccggctgccgcgcttg
ccccctcatggcaccatagcgcgccggctcatcgaacagtgtctcgccgaggcgcgttga

DBGET integrated database retrieval system