KEGG   Aeromonas caviae: VI35_19865Help
Entry
VI35_19865        CDS       T05190                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
acav  Aeromonas caviae
Pathway
acav03010  Ribosome
Brite
KEGG Orthology (KO) [BR:acav00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    VI35_19865
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:acav03011]
    VI35_19865
Ribosome [BR:acav03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    VI35_19865
  Bacteria
    VI35_19865
  Archaea
    VI35_19865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ATP92024
UniProt: A0A3N9Y946
Position
complement(4269589..4269933)
Genome map
AA seq 114 aa AA seqDB search
MEAIAKHRYARTSAQKARLVADQVRGLSVDKALNILTFSPKKAAVLVKKVLESAIANAEH
NEGADIDTLRVATIMVDEGPSMKRIRPRAKGRADRILKRTAHITVVVSDAKAGR
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggaagctatcgctaaacaccgttatgcccgtacttctgcccagaaagctcgtctggta
gccgatcaagtacgtggtctgtccgtagacaaggctctgaacatcctgaccttcagcccg
aaaaaggctgctgttctggtgaagaaagtgctggaatctgccattgccaacgctgagcac
aacgaaggtgccgatatcgacaccctgcgtgttgccaccatcatggtagacgaaggtccc
tccatgaagcgcatccgcccgcgtgccaaaggtcgcgcggatcgtatcctcaagcgtacc
gctcacatcactgtagtggtatccgacgctaaggctgggagataa

DBGET integrated database retrieval system