KEGG   Aeromonas caviae: VI35_20080Help
Entry
VI35_20080        CDS       T05190                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
acav  Aeromonas caviae
Pathway
acav00860  Porphyrin and chlorophyll metabolism
acav01100  Metabolic pathways
acav01110  Biosynthesis of secondary metabolites
Module
acav_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:acav00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VI35_20080 (hemN)
Enzymes [BR:acav01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     VI35_20080 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ATP92059
UniProt: A0A2X4NPJ1
Position
complement(4313804..4315177)
Genome map
AA seq 457 aa AA seqDB search
MQAEQIVWDQALIEKYNYSGPRYTSYPTALEFNEGFGYPDFVQAAGQYPARNLSLYVHIP
FCHKLCYYCGCNKVITRHQHKADQYLDYLEQEIKAQAPLFKERLVTQLHWGGGTPTYLSE
PQTRRLMAMLREHFHFAEEGEISIEVDPREIELSMLDVLRELGFNRISLGVQDFNKAVQV
AVNREQDNDFIRAMLVRARELGFRSTNLDLIYGLPHQNRESFHHTLEEVLKTDPARLSIF
NYAHLPSRFAAQHKLKEADMPAPQEKLAMLQDTIAFLTGQGYQFIGMDHFAKPDDELAVA
QREGKLHRNFQGYTTQGDCDLLGLGVSSISMMGDAYSQNQKDLKTYYAQVESLGHAQWKG
CSLNRDDLIRREVIKRLICDFSLNFAAVEQAHGLVFKEYFAEDLKLLQTFIDDGLVRMTE
EGLEVVSTGQLLIRNICMCFDVYLRSKARQQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagcagaacagattgtgtgggatcaggccctgatcgaaaaatacaactacagtggt
ccgcgttacacctcctatcccactgcgctggagttcaacgaggggttcggctatccggac
tttgtccaggcagcgggccagtatcctgcacgcaatctgtcgctctacgtgcatatcccc
ttctgtcacaagctctgctactactgcggctgcaacaaggtcattacccggcaccagcac
aaggcagatcaatacctcgactacctcgaacaggagatcaaggcccaggcccccctgttc
aaggagagactggtcacccagctgcactggggtggcggcacacccacctatctgagcgaa
ccccagactcgtcgcctgatggccatgttgcgggagcacttccacttcgccgaggagggg
gagatcagcatcgaggtggatccccgcgagatcgaattgtccatgctggatgtgctgcgg
gagctcggtttcaaccgcatcagccttggcgttcaggacttcaacaaggcggtccaggtc
gcggtcaatcgggagcaggacaacgacttcatccgcgccatgctggttcgtgcccgcgag
ctggggttccgctccaccaatctggatctcatctacggtctgccgcaccagaaccgggag
agcttccatcacaccctggaagaggtgctcaagaccgacccggcccgcctctccatcttc
aactatgcccacctgccgagccgttttgccgcccagcacaagctgaaagaagcggacatg
ccggcgccgcaggagaagctggccatgctgcaggacaccattgccttcctgaccggccag
ggttatcagttcatcggcatggaccactttgccaagcccgatgacgagctggccgtcgcc
cagcgcgagggcaagctgcatcgcaacttccagggctataccacccagggggattgcgat
ctgctggggctgggggtctcttccatcagcatgatgggggatgcctattcccagaaccag
aaggatctcaaaacctactacgcccaggtcgagtcactgggccatgcccagtggaagggg
tgctccctcaatcgggacgatctgatccgtcgtgaggtgatcaagcgcctcatctgcgat
ttttccctgaacttcgccgctgtggagcaggcccacggcctggtgttcaaggagtatttt
gccgaggatctcaagctgttgcagaccttcatcgacgacggtctggtgcgcatgaccgaa
gaggggctggaggtggtctccaccggtcagctgctgatccgcaacatctgcatgtgcttc
gatgtctacctgcgcagcaaggcgcgccagcagcagttctcccgggtgatctag

DBGET integrated database retrieval system