KEGG   Aeromonas caviae: VI35_20580Help
Entry
VI35_20580        CDS       T05190                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
acav  Aeromonas caviae
Pathway
acav00540  Lipopolysaccharide biosynthesis
acav01100  Metabolic pathways
Module
acav_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:acav00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    VI35_20580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:acav01005]
    VI35_20580
Enzymes [BR:acav01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     VI35_20580
Lipopolysaccharide biosynthesis proteins [BR:acav01005]
 Unusual sugar
  VI35_20580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR
Motif
Other DBs
NCBI-ProteinID: ATP92134
Position
complement(4414150..4415109)
Genome map
AA seq 319 aa AA seqDB search
MIVVTGGAGFIGSNLVKQLNAQGRTDIVVIDDLTDGTKFVNLVDLTIADYMDKDEFQARI
VSGDEFEEWDDGIEVIFHEGACSATTEWNGKFIMEVNYEYSKDLFHYCIEREIPFIYASS
AATYGGRNDNFIEDPRFEQPLNVYGYSKQLFDQYVRRWMPEINSQVVGLKYFNVYGPREQ
HKGSMASVAFHLNTQVKQGDNPKLFEGCDGFPDGGQMRDFIYVDDVCKVNLWFWQNPQLS
GIFNCGTGRAEPFQNVAEAVIRHHQKGAIEYIPFPDHLKGRYQSFTQADLTKLRGVGYDG
EFKTVAEGVADYMAWLNRA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtagtaactggcggtgctggctttatcggcagcaatctggtcaagcagctgaac
gctcaaggacggaccgatatcgtggtcatcgatgacctgaccgacggcaccaagttcgtc
aacctggtcgacctcaccatcgccgactacatggacaaggacgagttccaggcgcggatc
gtctccggtgacgagttcgaggagtgggatgacggcatcgaggtgatcttccacgaaggc
gcctgctccgcgaccaccgagtggaacggcaagttcatcatggaggtcaactacgagtac
tccaaggatctgttccactactgcatcgaacgggaaatccccttcatctacgcctcttcc
gccgcgacctatggcgggcgcaacgacaacttcatcgaagatccccggttcgagcagccc
ctcaacgtctacggctactccaagcagttgttcgatcagtacgtgcgtcgctggatgccg
gagatcaactcccaggtggtgggtctcaagtacttcaacgtctatggtccccgcgagcag
cacaagggctccatggcgtccgtggccttccacctcaatacccaggtgaagcagggtgac
aatcccaagctgttcgagggctgtgacggcttcccggatggcggccagatgcgcgacttc
atctacgtggacgacgtctgcaaggtgaacctctggttctggcagaatccgcagctctcc
ggcatcttcaactgcggcaccggccgggctgaaccgttccagaacgtagcggaagccgtg
atcaggcatcaccagaaaggcgccatcgaatacatccccttcccggatcacctcaagggt
cgctaccagagcttcacacaggcggatctcaccaagttgcgcggcgtcggctatgacggc
gagttcaagactgtggccgaaggcgtggccgattacatggcctggttgaaccgggcttga

DBGET integrated database retrieval system