KEGG   Acinetobacter baumannii ATCC 17978: A1S_0104Help
Entry
A1S_0104          CDS       T00486                                 

Definition
(GenBank) putative acetyl-coA synthetase/AMP-(fatty) acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb00010  Glycolysis / Gluconeogenesis
acb00620  Pyruvate metabolism
acb00640  Propanoate metabolism
acb00680  Methane metabolism
acb01100  Metabolic pathways
acb01110  Biosynthesis of secondary metabolites
acb01120  Microbial metabolism in diverse environments
acb01130  Biosynthesis of antibiotics
acb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A1S_0104
   00620 Pyruvate metabolism
    A1S_0104
   00640 Propanoate metabolism
    A1S_0104
  Energy metabolism
   00680 Methane metabolism
    A1S_0104
Enzymes [BR:acb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     A1S_0104
Lipid biosynthesis proteins [BR:acb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   A1S_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABO10591
Position
124193..125839
Genome map
AA seq 548 aa AA seqDB search
MDYQNAVQAFDLESTAKQMLSGSLDALNACYECCDRHADGDKIALYWQGKDGRKEQYTFR
ELKEWSSQFANFLKAQGVKTGDRISGLLPRTPELIVTILAAWRIGAVYQPLFTAFGPKAI
EHRIQLAQSKLVVTDMGNRSKLEEIEKCPAIVTVADAQGTPLKAGDFNFWNEVKQQSDQC
DLVMRSIQDPFLLMFTSGTTGPAKPLEVPLKALIAFGRYMQDAIGLTEEDSFWNIADPGW
AYGLYYAITGPLFLGHATLFYEGGFSTDSLCQIVKDYKVNNLAGAPTAYRMMMAADPAQM
APLKGQFRVVSSAGEPLNPEVIRWFKQVLDAPIYDHYGQTEVGMVVCNHHGLKHEIHAGS
AGFPSPGYRVAIVNEQGEELPPDTPGILAVDISQSPMMWFGGYKESRKSPFVGHYYLTGD
TAELHADGSMSFVGRSDDVITTSGYRIGPFDVESALLEHDAVIEAAVIGVPDPDRTEVVK
AFVILATGVQPTEALAEELSQFVKRRLSAHAYPRLVEFVSELPKTPSGKIQRFLLRNQEI
AKQQAKAG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggattatcaaaatgctgtacaggctttcgatttggaaagcactgctaaacagatgttg
tcaggttcactcgatgcacttaacgcatgttatgaatgctgtgatagacatgcagatggc
gacaaaatcgcgctgtactggcaaggaaaagacggccgtaaagagcaatataccttccgt
gaactaaaagaatggtcaagtcagtttgctaactttttaaaagcacaaggtgtgaaaact
ggtgaccgtatttcagggttattaccaagaacacctgaactgattgtaactattttggcg
gcttggcgaattggtgcggtgtaccaacccctatttactgcctttggtcccaaagcgatt
gagcaccgtattcagcttgcacaaagtaagctggtggtgaccgatatggggaatcgtagc
aagcttgaagaaattgaaaagtgccctgcaattgtgacggtggcggatgcacaaggtact
ccgctcaaagcaggggattttaatttctggaatgaagtgaagcagcagtctgatcaatgt
gatctagtcatgcgtagcatccaagatcctttcttgctcatgtttacttcgggcacaaca
gggcctgcaaaacccttagaagtaccactaaaagcactgattgcctttggtcgatatatg
caagatgccattggtttaactgaagaagattcattctggaatattgccgatccgggttgg
gcgtatggtttgtactatgcgattactgggccattattcttgggccacgctactttgttc
tatgaaggtggttttagtaccgatagcctatgccaaattgtgaaagattataaagttaac
aacttggcaggtgcaccgactgcttaccgcatgatgatggcggctgacccagcgcaaatg
gcaccgttaaaaggtcagttccgtgtggtgagcagtgcaggtgagccactcaacccagaa
gtcattcgctggtttaaacaggtccttgatgctccgatttatgaccactatgggcaaaca
gaagtcggtatggtggtgtgtaatcatcatggcttaaaacatgaaattcatgctggttca
gcaggttttccaagtccgggctaccgtgttgcgattgtcaatgaacaaggtgaagaactt
ccgccagacacaccgggaattttagccgtcgatattagccagtctccaatgatgtggttt
ggtggctataaagaaagccgtaaatcgccttttgttggtcattactacttaacgggtgat
actgcagaacttcatgccgatggcagcatgagctttgttggtcgtagtgatgatgtgatc
accacatcgggttatcggattggacctttcgatgtagaaagtgctttactcgaacatgat
gctgtcattgaggcagcagtgattggtgtgcctgatccagaccgtaccgaagtggttaag
gcttttgtgattttagctacgggtgttcagcctacagaggcacttgctgaagaactcagc
cagtttgttaaaagacgactttctgctcatgcttacccacgtttagttgaatttgtgagt
gaattacctaaaactccaagtggtaaaattcagcgctttttattgcgtaatcaagaaatt
gctaaacaacaagctaaagcagggtaa

DBGET integrated database retrieval system