KEGG   Acinetobacter baumannii ATCC 17978: A1S_0106Help
Entry
A1S_0106          CDS       T00486                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb00071  Fatty acid degradation
acb00280  Valine, leucine and isoleucine degradation
acb00281  Geraniol degradation
acb00310  Lysine degradation
acb00360  Phenylalanine metabolism
acb00362  Benzoate degradation
acb00380  Tryptophan metabolism
acb00410  beta-Alanine metabolism
acb00627  Aminobenzoate degradation
acb00640  Propanoate metabolism
acb00650  Butanoate metabolism
acb00903  Limonene and pinene degradation
acb00930  Caprolactam degradation
acb01100  Metabolic pathways
acb01110  Biosynthesis of secondary metabolites
acb01120  Microbial metabolism in diverse environments
acb01130  Biosynthesis of antibiotics
acb01212  Fatty acid metabolism
Module
acb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A1S_0106
   00650 Butanoate metabolism
    A1S_0106
  Lipid metabolism
   00071 Fatty acid degradation
    A1S_0106
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A1S_0106
   00310 Lysine degradation
    A1S_0106
   00360 Phenylalanine metabolism
    A1S_0106
   00380 Tryptophan metabolism
    A1S_0106
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A1S_0106
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A1S_0106
   00281 Geraniol degradation
    A1S_0106
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A1S_0106
   00627 Aminobenzoate degradation
    A1S_0106
   00930 Caprolactam degradation
    A1S_0106
Enzymes [BR:acb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A1S_0106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABO10593
Position
127000..127773
Genome map
AA seq 257 aa AA seqDB search
MQWQSILLEKRNGVGLITLNRPQALNALNSELISEINQALDQLEKDRGIGCIVLAGSEKA
FAAGADIKEMADLAFPDIYLDDFFHLADRIAQRRKPLIAAVSGYALGGGCELALMCDFIY
CADNAKFGLPEVTLGVIPGIGGTQRLTHAIGKAKAMEMCLTARQMGAVEAEQSGLVARVF
AKEELLEQTLQAAEKIAARSLTANIMLKETINRAFEVNLTEGLRFERRMFHSIFATFDQK
EGMQAFVEKRKANFKNQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggcaaagtattttattagaaaagcgtaatggggttggactgattaccttaaat
cgccctcaagcgctcaatgctttaaacagtgaattaattagtgaaattaatcaggcatta
gatcagctcgaaaaagaccgtggaattggttgcatcgtattggcaggttctgaaaaggct
tttgccgcaggtgccgatattaaagaaatggctgatttagcattccctgatatttattta
gatgactttttccatcttgcagaccgtattgcacagcgtcgtaaacctttaattgctgcg
gtgagtggctatgcgttgggtggtggctgtgaattggcgctcatgtgtgactttatatat
tgtgctgacaacgccaagtttggcttacctgaagtgaccttgggtgtaattccgggtatt
ggtggcacacaacgattaacccatgccattggtaaagccaaagcaatggaaatgtgcctt
accgctcgtcaaatgggtgcggtagaggcagagcaaagtggtttagttgcgcgtgtgttt
gctaaagaagaattacttgaacaaaccttgcaagcagctgaaaaaattgcggcacgatct
ttaactgcaaacatcatgcttaaagaaaccattaaccgagcttttgaagtaaacctcaca
gaaggcttgcgttttgaaagacgtatgttccattcaatatttgcaacatttgaccaaaaa
gaaggaatgcaggcgttcgttgaaaaacgaaaggcaaattttaaaaatcagtaa

DBGET integrated database retrieval system