KEGG   Acinetobacter baumannii ATCC 17978: A1S_0468Help
Entry
A1S_0468          CDS       T00486                                 

Definition
(GenBank) hypothetical protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:acb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A1S_0468
Enzymes [BR:acb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     A1S_0468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: ABO10923
UniProt: A3M1X9
Position
complement(506310..506933)
Genome map
AA seq 207 aa AA seqDB search
MSTPHWFDQGSLVLASNNKGKVAEFEKLFEQLKLPVEIIPQGRLNIPDAIEDGLSFIENA
IIKARHASKISGKPAMADDSGICVPVLGGAPGIYSARYAGEHGDDAANNAKLLNDLLPFR
KNGEVIEGMFVCVLALVTHAEDPLPQIFQGIWHGEILEAPRGENGFGYDPLFWLPELQVS
SAELSKEEKNKISHRGQAMQLFRESLV
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccccacattggtttgatcagggctctttagtccttgcaagtaacaacaaaggt
aaagtcgcagagtttgaaaaactttttgaacagcttaagttgcctgtagaaattattcct
cagggtcgcctaaatattcccgatgccattgaagacggcttaagctttattgaaaatgcc
attattaaagcgcgtcatgcctctaaaatttcaggtaaacctgctatggctgacgactct
ggtatttgtgtaccagtcttaggcggcgcacctggtatttattcagcacgttatgctgga
gaacacggtgacgatgcagcgaacaatgccaaattattaaatgatcttttaccatttcgt
aaaaatggtgaagtgattgaaggcatgtttgtgtgtgtacttgctctagtaacgcatgcg
gaagatccattgccacaaattttccaaggcatctggcatggtgaaattttagaagcgcca
cgtggtgaaaatggttttggctatgacccactgttctggttacccgagcttcaagtttct
agtgctgagttgtctaaagaagaaaaaaataagattagtcatcgtgggcaagcgatgcag
ttatttagagaaagtttagtataa

DBGET integrated database retrieval system