KEGG   Acinetobacter baumannii ATCC 17978: A1S_0972Help
Entry
A1S_0972          CDS       T00486                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
acb  Acinetobacter baumannii ATCC 17978
Brite
KEGG Orthology (KO) [BR:acb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A1S_0972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABO11404
Position
1126786..1128321
Genome map
AA seq 511 aa AA seqDB search
MPVFLTIIIATLIYIGFQVSADLAHVPPLSLYSVILLSTALLIALGFEFVNGFHDTANAV
ATVIYTNALPAPVAVMWAGFCNFLGVMVASGAVAYGIIALLPVELIMNMGSGAGFAMVFA
LLIAAILWNLGTWFLGIPASSSHTLIGSILGVGIMNHLLSASTGVTTSGVDMDQVIKVGK
ALLFSPLIGFAFAAIVFLLVKTIFKRQLELFQPPEGNKPPPAIIRAILIFTCTGVSFAHG
SNDGQKGMGLIMLILVGLVPLAYSLNKNLDTQQVQSFHQLSSQTAVLLNQNQPELTDEKA
RAVLTKYIQTKQQTPEVVPALASMTDHLGERVSSYSNLKDIPEAAISEIRNDMYLSTTTF
KRLDKADALPKMDDSQKKLVKDYRSSLDSFLQYIPNWVKVAVALALGLGTMVGWKRIVVT
VGERIGKHHMTYGQGMSAELVAMSTIAAADGLGMPVSTTHVLNSAVAGTMVANKSGLNFN
TVKTILSAWVFTLPATICLSGGLYWLFLQFV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgtttctgacgattattattgcaacacttatttatattgggtttcaggtcagt
gctgatttagcacatgttccacctttaagcctttattcagttattcttttatctactgca
ctcttgattgcactaggctttgaatttgtaaacggtttccatgacactgctaatgcagtt
gcaacggttatttatacaaatgctttgcctgcaccggttgcagtcatgtgggcaggtttt
tgtaatttccttggggtaatggtcgcaagtggtgctgttgcgtatggcattattgcattg
cttccagttgaacttattatgaacatgggcagtggtgctggctttgcaatggtttttgca
ttgttgatcgctgcaattctttggaatcttggtacttggttcttgggaattcctgcttct
agctctcataccttgattggttcaatcttaggtgtgggtattatgaatcatctgttgagt
gcatcgactggcgtaacgaccagtggtgttgatatggatcaggtgattaaagtaggtaag
gcattattattttctcctttaattggttttgcttttgcggcaattgtattcttgttggtt
aaaactattttcaaacgccaattagaattattccagccacctgaagggaataagccacca
ccagcaatcattcgcgcaattcttatctttacctgtacaggtgtgagttttgcacatggt
tctaatgatggccaaaaaggtatgggtcttatcatgctgattttggttggtttggtgcca
ttagcttattcattaaataaaaacctcgatacacagcaggttcaatcattccatcagctt
tcttctcaaactgcggttttgttaaaccaaaatcaaccagaattgactgacgaaaaagcg
cgtgcggttttaactaaatacattcaaaccaagcaacaaacgcctgaagttgtgcctgca
ttggcaagcatgactgaccatttgggtgagcgtgtttctagctatagcaacttaaaagat
attccagaagctgcaattagcgaaatccgtaatgacatgtatttgagcacaacgacgttt
aagcgtttggataaggcagatgctttaccaaaaatggatgactcacagaaaaagcttgtg
aaagattatcgtagtagcttggattcattcttacaatacattccaaactgggtgaaagtg
gcagtcgcattagcgcttggacttggtactatggttggctggaaacgtattgtggtaact
gtcggtgagcgtattggtaagcatcacatgacttatggtcaagggatgtctgctgaactt
gttgcaatgagtacaattgctgcagcagatggtttaggtatgccggtttcaacaacacac
gttttaaacagtgctgttgcaggtactatggttgccaataaatcaggcctgaatttcaat
actgtaaaaacaattctctctgcatgggtatttacccttcctgcaaccatctgtttgtct
ggtggtctatactggttgttcttacagtttgtataa

DBGET integrated database retrieval system