KEGG   Acinetobacter baumannii ATCC 17978: A1S_1288
Entry
A1S_1288          CDS       T00486                                 

Definition
(GenBank) putative VGR-related protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A1S_1288
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acb02044]
    A1S_1288
Secretion system [BR:acb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A1S_1288
SSDB
Motif
Pfam: Phage_GPD
Other DBs
NCBI-ProteinID: ABO11716
Position
1511966..1513246
AA seq 426 aa
MQSNESDYDFLTRLWRSEGINWLVDESQLFVADPNASIQPQVLRLIDDNQNYQALERRSI
RYQRSSATEQFDTITQVKAERRLQPTSVHVQRWQADALQQEEGSGSVQGTQKHSEHYDNA
SLNLEDAWHVSPAWMQDLNGKDQATASGNSQIEQLNQHINAYHHLSSKQFTVAGNVRDAQ
VGYWFELNDHPELDQHDSADKEFLILSKHYYNQNNLPKELQQQLERLLPQGKLKAAQLDS
QNPEQRHFAELNVVRRNIKAVPEYNPLEHRPAAHPQRARVVGLEGESIHVDQWGRIKVRF
LLPELMTTAMMVELEVTTMTPTRLGSMYSLLGQGQVMAHVSCHVLVKLLSSISLTVMLTA
RLWWGVFMKPSANQRSSTRKASYLTPRNLAVSVQKKSMAKALTSSVLMTPQAKSVPSYKV
AMPQAS
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgcagtcaaatgaaagcgattatgactttttaacccgtttgtggcgtagtgaaggtatt
aactggctggtcgatgagtcacagctttttgtcgctgacccaaatgcttctatccagcca
caagtactgcgtttaattgacgataaccaaaattatcaggcacttgaacgccgtagcatc
cgctatcaacgcagcagtgcgacagagcagttcgatacgattacccaagtcaaagctgag
cgtcgtttacaaccaacctcggttcatgtgcaacgctggcaagccgatgctttgcaacaa
gaagaaggtagcggcagcgtacaaggcacccaaaagcacagcgaacactatgacaatgcc
agcctgaaccttgaagatgcatggcatgttagcccagcgtggatgcaggatttaaacggg
aaagatcaagccacagcttcgggaaatagccagattgaacaacttaaccagcacatcaat
gcttaccatcacctgagttctaaacagtttaccgttgcaggtaacgtccgtgatgcacaa
gtgggttactggtttgagctgaatgaccatccggaacttgaccaacatgatagtgctgat
aaagagttcttaatcttaagcaaacactactataaccagaataatttaccgaaagaatta
caacaacaacttgagcgcctattaccacaaggcaaactcaaggcagcccaactcgacagc
caaaaccctgagcagcgccactttgctgagctgaatgtcgttcgtcgtaatattaaagct
gtgcctgaatataacccgttagagcaccgaccagccgctcacccacagcgcgctagagtg
gtgggtttagagggtgaaagcattcatgtcgaccagtggggacgcattaaagtccgtttc
cttttacccgagctgatgaccacagccatgatggtggagctggaagtaacgacaatgaca
ccgactcggcttgggtcgatgtactcactccttgggcaggggcaggttatggcgcacgtt
tcttgccacgtgttggtgaaattgttgtcatcgatttctttgacggtaatgttgaccgcc
cgtttgtggtggggcgtattcatgaagccgagcgccaaccaacgcagttcgaccagaaag
gccagctacctgacaccaagaaacttagcggtatccgttcagaagaagtcgatggcaaag
gctttaaccagctccgttttgatgacaccacaggccaaatcagtgcccagttacaaagta
gccatgccgcaagccagctaa

DBGET integrated database retrieval system