KEGG   Acinetobacter baumannii ATCC 17978: A1S_1289
Entry
A1S_1289          CDS       T00486                                 

Definition
(GenBank) putative VGR-related protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A1S_1289
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acb02044]
    A1S_1289
Secretion system [BR:acb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A1S_1289
SSDB
Motif
Pfam: DUF2345 T6SS_Vgr DUF3540 Sarcoglycan_1
Other DBs
NCBI-ProteinID: ABO11717
Position
1513051..1514238
AA seq 395 aa
MVGRIHEAERQPTQFDQKGQLPDTKKLSGIRSEEVDGKGFNQLRFDDTTGQISAQLQSSH
AASQLNLGNLSHPKDKAESDGRGEGFELRTDQWGAVRAGSGLLISTHKQDQAQGVHLDAS
EAKQQIEGGLNNAKALSEVAKNQQTDPLDMLENIQTFLEVLKQEDPKKAAEFQSAVMLLA
SPKSIAVSSNEDIHLSANGQLTQSAGDSINMSTQKNIVNHASQKISLFAAQEGARLFAGK
GKVEIQAQGDGLDVIARKGIQITSTEDTVFITSPTEINLTANGSQVKLNGSGIFPVTGGK
LEVKAGQHLFMGGEQVTPPKKQENKPCYLTFEITDLDGKPAKNVEYIAFRMDGSRQKGQT
NAQGLTQRFETDGSEQISIHICDENASKYKLAAKG
NT seq 1188 nt   +upstreamnt  +downstreamnt
gtggtggggcgtattcatgaagccgagcgccaaccaacgcagttcgaccagaaaggccag
ctacctgacaccaagaaacttagcggtatccgttcagaagaagtcgatggcaaaggcttt
aaccagctccgttttgatgacaccacaggccaaatcagtgcccagttacaaagtagccat
gccgcaagccagctaaacttgggtaacttaagccatccaaaagacaaggcggaaagcgat
ggtcgtggggaaggttttgaactcagaactgaccagtggggcgcggttcgagcaggcagt
ggcttactcattagtacccacaaacaggatcaggctcaaggtgtacatcttgatgcaagc
gaggctaagcaacaaatcgaaggcggcctcaataatgccaaggcactcagtgaagttgct
aaaaatcagcaaactgacccgttagatatgcttgagaatattcagacttttttagaagtt
ctcaaacaagaagatcctaaaaaagctgctgaatttcaatcagcagtgatgctgctggca
tcaccaaaaagtattgctgtaagtagtaatgaagatatacacctcagtgcaaatggtcag
ctcactcaaagtgctggagatagcattaatatgagtacgcaaaagaatatagtgaatcat
gcgagccaaaagattagtctctttgccgctcaggagggtgctcgactttttgctgggaag
ggcaaagtagaaattcaagctcaaggtgatggcttagatgtcattgctcgaaaaggtata
cagattacttcaaccgaagacacagtttttattactagcccaactgagattaatctgaca
gcaaacggatctcaagttaagctgaacggttcaggtattttccctgtcacgggtggtaag
cttgaggtgaaggctgggcagcacttgtttatggggggagaacaagttactcctcctaaa
aagcaggaaaataaaccttgttatttgacttttgaaattactgatttagatggaaagcca
gcgaaaaatgtagagtatattgcttttagaatggatggtagccggcaaaagggacaaact
aatgcccaaggtttaactcaaagatttgaaactgatggctcagaacaaatttccattcat
atttgtgatgaaaatgcttctaaatataaactagcggcaaaaggttaa

DBGET integrated database retrieval system