KEGG   Acinetobacter baumannii ATCC 17978: A1S_1293
Entry
A1S_1293          CDS       T00486                                 

Definition
(GenBank) hypothetical protein
Organism
acb  Acinetobacter baumannii ATCC 17978
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABO11721
Position
1519781..1519930
AA seq 49 aa
MFRLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKNSLMSI
NT seq 150 nt   +upstreamnt  +downstreamnt
gtgttcagacttacatatgatgtcgaaattggtgatgcgaaagaagcgaaagaactacca
ttcgttgtaggtgtaatgggtgatttttcagctgcatctgagcttgagcgtacaaaatta
aaagataaaaattcattaatgtcgatttag

DBGET integrated database retrieval system