KEGG   Acinetobacter baumannii ATCC 17978: A1S_1294
Entry
A1S_1294          CDS       T00486                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
acb  Acinetobacter baumannii ATCC 17978
Brite
KEGG Orthology (KO) [BR:acb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acb02044]
    A1S_1294
Secretion system [BR:acb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A1S_1294
SSDB
Motif
Pfam: T6SS_VipA SPT16
Other DBs
NCBI-ProteinID: ABO11722
Position
1519993..1520232
AA seq 79 aa
MTEEGGKMAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNSERLEDLLD
EVLKNTDQIRKLSAEADHE
NT seq 240 nt   +upstreamnt  +downstreamnt
ttgacagaagaaggcggtaaaatggctgttgatttaacatttaaatcaatggaagatttt
cgcccggaaaatgttgtacagcaagttgatccattaaagaaattggttgaggcgcgtgag
cgtttaaccgatttaagaaacaaaatttcaaacagtgagcgtttagaagatctgcttgat
gaggttcttaaaaatactgatcaaatccgtaaattaagtgcggaggccgatcatgaataa

DBGET integrated database retrieval system