KEGG   Acinetobacter baumannii ATCC 17978: A1S_1302Help
Entry
A1S_1302          CDS       T00486                                 

Definition
(GenBank) putative membrane protein
  KO
K11891  type VI secretion system protein ImpL
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A1S_1302
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acb02044]
    A1S_1302
Secretion system [BR:acb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A1S_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ABO11730
Position
1527124..1530249
Genome map
AA seq 1041 aa AA seqDB search
MSSYTSIPRHIFWDLASAYALGLIAYGIYWLIQRKKHAVQGEELAQAIEKDTQAEYGKNK
DKEELQLISQQMKESIQLIRKSKLGDKKGNAALYELPWYMVIGNPAAGKSSAIYNSGLKF
PFEETHQKMVSAGLSGTRNCDWFFSTEGILLDTAGRYSVYSEDHSEWLGFLNILKKNRSK
APVNGLILIVSIAELVSQSPEHSLKLAKNLRARIQDLTERLEVVVPVYLVFSKMDLIAGF
TEFFEFYEAQEYNQAWGATLPYEQNSSHNAVDLFEKHYNILYDGLKGVSSTHLSRRHSQN
ISPSVMTFPLEFKTLKPALKSFIATLFEDNPYQFQPVFRGFYFTSALQEGVIESPMTEQI
AQEFQLSQIAQSEVKDQLKTTPNHGYFLKGLFSDVILKDKDLVKQHVNTSKKRQRYIAFI
GALAGVSIILGVWVWSYRNNQQLIAEVQADLNKVVQLEKSSGQQLSTQLEALLVLQRRLQ
QLDEFDENRPLKFSFGLYQGNELREKLKAEYLKGVKQIVLIPTQQNIAQYLQRVKNNEAT
LKANHTNVEIKQTAQTQQYLEPSDTNPQDAYNALKAYLMMSNPQYMDASHLSDQVTRFWR
SWLDANKGQMPRADMIQEAEQILSYAMTLANDKQFPILDADSQLVDQTRQVLLSVIRGMP
ARDRVYNQIKMRAAVRFPALTVSQIVGDANKNIVLGSYALPGVFTQKAWNEYVEKAMEEA
ADKPTDTKDWVLNSRQSDDLTFSGSPEQIRKQLTALYKQEYIAEWRKFLSGIHYAKATQF
AQQVKNIDVLGEPQNSPIRTLIERVAIETNWDNPVVQAELAAPQKGFIAWFKRKVLNHDD
KQLANQAVTNAQGPISQEYQMFYQLVRKRDDQQGKSLLDEYMTNLALVRSKFNELKNAGE
IGPNAMTLVKQTLNEQTSVFNQTQKIVDEKMAVGFSEIDQQLLQKLVVSPLTQAFESLIT
PTQDEINKLWVMQAYQPFTANLAKKYPFNSSASLQATSSEIGQILGENGSISRFVKESLD
PFVIRRGYTLTSKHGKIWGLV
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctatacttcaattcctcgccatatattttgggatttagcatctgcatatgct
ttagggctcatcgcttatggaatttattggctaattcagcgtaaaaagcatgctgttcaa
ggtgaagagcttgcgcaagcgattgaaaaggatacccaagcagagtacggcaaaaataaa
gataaagaagagctgcaacttattagccaacaaatgaaagaatctattcaattgattcgt
aagtcaaagttaggcgataaaaaggggaacgcagcactatatgagttgccatggtatatg
gtcattggtaacccggctgctggtaaaagttctgcgatctataattccggtttaaagttt
ccttttgaagaaacccatcaaaaaatggtttcggctggtttaagcggtacgcgtaattgt
gactggtttttttcaactgagggtattttactcgacaccgctggacgttattcagtctat
agcgaagatcactctgaatggttaggctttttaaatatcttaaagaagaaccgttcgaag
gctccagtaaatggtttaattcttattgttagtattgctgagcttgttagtcagagtcca
gaacactcattaaagcttgcgaaaaatttacgcgctcgtattcaggatttaactgaacgt
ttagaagtggttgtacccgtatatctagtcttttcaaaaatggatttgatcgcgggtttt
actgaatttttcgaattctatgaagcacaagaatataatcaggcgtggggtgcaacacta
ccatatgagcaaaactcttctcataatgctgtagatctttttgagaaacactacaatatt
ctttatgacggtttaaaaggggtcagttcaactcatcttagccgtcgacattctcaaaat
atctcacctagtgtgatgactttcccattagaatttaagacattaaaacctgcattaaaa
agttttattgcgacactgtttgaagataacccttaccagttccaaccagttttccgtggg
ttttatttcacgagtgctttgcaagaaggcgtaatagaaagtccaatgactgagcaaatt
gcacaggaattccagctttcccaaattgctcaaagtgaagtaaaagatcaactaaaaaca
acgcctaaccatggttatttcttaaaaggcttgttttcagatgtcattttaaaagataaa
gatctggttaaacagcatgtcaatacaagcaaaaagcgtcagcgttatattgcatttatt
ggtgctttagctggcgtatccattattctaggtgtgtgggtttggtcatatcgtaacaat
caacaacttattgctgaagttcaagctgatttaaataaagttgttcaattggaaaagagt
tcaggtcaacaattgtcgactcaattagaggccttacttgtcttgcaaagacgtctacaa
cagttagacgaatttgatgaaaatagaccactaaaatttagttttggtttatatcaaggt
aatgagctacgtgaaaaattaaaagctgaatatttaaaaggtgttaagcaaattgttttg
atacctacacagcaaaatattgctcagtatttgcaacgtgtaaaaaataacgaagcaact
ttaaaagcaaatcataccaatgttgagatcaagcaaactgctcaaactcagcaatattta
gagccttcggataccaaccctcaagatgcttataatgctttaaaagcatatttaatgatg
agcaatccacagtatatggatgcaagtcacttaagtgatcaggtaacgcgtttctggcgt
tcttggcttgatgccaataaagggcagatgccacgtgcagatatgatccaagaagctgag
cagatcttatcttatgcaatgacattggcaaatgataaacaattcccgatcttggatgct
gactctcaactcgtggatcagacacgtcaagtattgctctctgttattagaggtatgcca
gcacgtgaccgtgtttataatcaaattaaaatgcgtgctgctgtgcgctttccagcttta
actgtaagccagattgtaggtgatgcaaataaaaatattgtattgggtagttatgcatta
ccaggggtatttactcaaaaagcttggaacgagtatgtagaaaaagcaatggaggaagca
gcagacaaacctacggatactaaagactgggtgcttaatagccgtcaatctgatgattta
actttttctggtagtccagagcaaatcagaaagcagcttactgcattgtataaacaagaa
tatattgcagagtggagaaaattcttaagtggtattcactatgcaaaagcaactcagttt
gctcagcaagttaaaaatattgatgtattgggcgaaccacaaaattcaccaattcgcaca
cttattgaacgcgtagccattgaaacaaattgggataatccggtcgttcaagccgagtta
gcagcacctcaaaaaggatttattgcatggtttaaacgtaaggttttaaaccatgatgat
aaacaattagcaaatcaggctgtaacgaatgctcaagggcctatttctcaagaatatcaa
atgttctatcaattggttcgtaaacgtgatgatcagcaaggtaaatctttgcttgatgaa
tatatgacgaatcttgccttagtacgtagtaagtttaatgaacttaagaatgcgggtgag
atcggaccgaatgcgatgacattggttaagcaaactttaaatgagcagacatcggtattt
aaccagactcaaaaaattgtagatgaaaagatggcggttggtttcagtgaaattgatcag
caacttctacaaaaattagtggtgagtccacttacccaagcctttgaaagtttaattaca
cctactcaagatgaaattaataagctatgggtaatgcaagcctatcaaccatttactgca
aatcttgctaagaaatatccatttaactcatcagcttctttacaagcaacaagtagtgaa
attggacaaattcttggtgaaaacggcagtatttcccgttttgttaaagagagtttagat
ccgtttgttatccgccgtggttatactttaacttcaaaacatggaaagatttggggatta
gtttaa

DBGET integrated database retrieval system