KEGG   Acinetobacter baumannii ATCC 17978: A1S_1701Help
Entry
A1S_1701          CDS       T00486                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb00010  Glycolysis / Gluconeogenesis
acb00020  Citrate cycle (TCA cycle)
acb00620  Pyruvate metabolism
acb01100  Metabolic pathways
acb01110  Biosynthesis of secondary metabolites
acb01120  Microbial metabolism in diverse environments
acb01130  Biosynthesis of antibiotics
acb01200  Carbon metabolism
Module
acb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A1S_1701
   00020 Citrate cycle (TCA cycle)
    A1S_1701
   00620 Pyruvate metabolism
    A1S_1701
Enzymes [BR:acb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A1S_1701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABO12128
Position
1978428..1979918
Genome map
AA seq 496 aa AA seqDB search
MEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLI
AVCADSEVSDAEIEKFIASLGGSAAQAPEAPSEQSKAETSAPVAEKTEQPQTVAASASAP
AKVAKEDYAVPESLQGYQTSNELFATPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKA
VQAAGGQWPDVKQQTQAKVVKSTADDSQVLATPVARRLAKQWGINLNDCRVSGTRGRVCK
EDVEAVYYRNNPTSVNEQPVQCAAQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVV
DLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQA
DISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLG
MLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKF
LASFKQFVENPALILV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggcacgatcgcccaatggttgattaaagagggtgatagctttaataaaggc
gatgaaatttgtgaaattgaaaccacaaaaatcgtcaatgtgttagaagcgccttttgct
ggaacgctccgtaaaattttagcgaaagatggtgatactttacctgttggtggtcttatt
gccgtatgtgctgatagtgaagtttctgatgcagaaattgaaaagtttattgcatcacta
ggtggttcagcagctcaagccccggaagcaccttcggagcaaagtaaagcggaaacatct
gcacctgttgctgaaaaaacagaacaaccacagactgtagcagctagtgcttcagctcct
gcaaaggtagcgaaagaggactacgctgtaccagagtcattacaaggctatcaaacatct
aatgagttgtttgcaacaccgcatgccttgaagcttgcagaaaaacacaatgtaaacttg
gcaaaagtcacaggttctggtcgtgaaggacgtattagtgttcaagacatccagaaagct
gtacaagctgctggtggtcaatggcctgatgttaagcagcaaactcaagctaaagtggtt
aaatctacggccgatgatagccaagttttagcgacgcctgtagcacgtcgtttagcaaag
cagtggggcattaacctaaatgactgtcgtgtttcaggtactcgtggccgtgtctgtaaa
gaagatgttgaggcagtttactatcgtaataacccaacatcggtaaatgaacaacctgta
caatgtgcagcccaaccacaatcaaccgttacgacggtggcgatgaatgggatgcgtaaa
gcgattgcttcacggttacaggctgcaaaacgtaacgcaccgcatttccgtttagtggtc
gatctcaacgtagaagctttgcaaaaactacgtaagcagattaatgagactgttccacaa
gtcaaactttctattaatgacatgctaattaaggcagctgccgccgcactgattaaagta
cctgaggtgaatgttcaatttgatgaggcgacccaatcaattttacagttctctcaagcg
gatatttcggtggccgtagcgattccaaacggtttaattacacccattgtaaaagcagca
aatcagaagtctttagcacaaatttccgatgacatgcgtgatttggcaacgcgtgctaag
actggcaagttacaacctgacgagtttcagggaggcagctttagcatttcaaatttagga
atgttaggcattaaacagttcgatgccattatcaacccaccgcaaggtgcaattatggca
ttaggtgcttcggaatctcgcgctgttgttgaaaatggcaatgtagtggttcgtgagatt
gtcacagcgacgttgtcatgcgatcaccgagttattgatggcgcagttggggcgaaattc
ttggccagctttaagcagtttgttgaaaaccctgctttaattttggtgtag

DBGET integrated database retrieval system