KEGG   Acinetobacter baumannii ATCC 17978: A1S_1729Help
Entry
A1S_1729          CDS       T00486                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb00071  Fatty acid degradation
acb00072  Synthesis and degradation of ketone bodies
acb00280  Valine, leucine and isoleucine degradation
acb00310  Lysine degradation
acb00362  Benzoate degradation
acb00380  Tryptophan metabolism
acb00620  Pyruvate metabolism
acb00630  Glyoxylate and dicarboxylate metabolism
acb00640  Propanoate metabolism
acb00650  Butanoate metabolism
acb00900  Terpenoid backbone biosynthesis
acb01100  Metabolic pathways
acb01110  Biosynthesis of secondary metabolites
acb01120  Microbial metabolism in diverse environments
acb01130  Biosynthesis of antibiotics
acb01200  Carbon metabolism
acb01212  Fatty acid metabolism
acb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A1S_1729
   00630 Glyoxylate and dicarboxylate metabolism
    A1S_1729
   00640 Propanoate metabolism
    A1S_1729
   00650 Butanoate metabolism
    A1S_1729
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A1S_1729
   00072 Synthesis and degradation of ketone bodies
    A1S_1729
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A1S_1729
   00310 Lysine degradation
    A1S_1729
   00380 Tryptophan metabolism
    A1S_1729
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A1S_1729
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A1S_1729
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A1S_1729
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acb04147]
    A1S_1729
Enzymes [BR:acb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A1S_1729
Exosome [BR:acb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A1S_1729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417 PepSY_2
Motif
Other DBs
NCBI-ProteinID: ABO12156
Position
complement(2011427..2012599)
Genome map
AA seq 390 aa AA seqDB search
MSSIVIVSGSRTAMGGFQGSLSSLTAPELGAAVIRESIQRAGVKPEQVDEVIFGCVLSAG
IGQGPARQAMRKAGVPDHVGAVTINKLCGSAMKAVLMASDTLKAGSANIIVAGGMESMTN
APYILPKARGGYRMGHGEIKDHMFLDGLEDAETGRLMGSFAQDMANTKGFTREQMDDFAI
SSLKKAQTAITEGYFKEEIVPVEVKTRKGVEVIDQDEQPLKANLEKIPTLRPAFSKDGTI
TAANSSSISDGAAALVLTTEEYAQSHGLNTLAKIVATSTHSQHPSEFTIAPISAIQKVLE
RAGWSVDEVDAWEINEAFAMVAMAPIHELGIDEAKVNVHGGACALGHPIGATGSRIILSL
IYALKRLGKKKGVAALCIGGGEATAVAIEI
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaattgttatagtttcaggtagccgtactgcaatgggtggttttcagggtagt
ttatcttctctaactgctccagaacttggcgctgctgtcatccgtgaatcgatccaacgt
gcaggtgttaagcctgaacaagtagatgaagtgattttcggttgcgtactcagtgcaggt
attggtcaaggccctgctcgtcaagccatgcgtaaagctggcgtgcctgatcatgtcgga
gctgtgaccattaataaactttgcggctctgcaatgaaagcggtcttaatggcatcagat
accttaaaagcaggtagtgccaatattattgtggctggcggcatggaatctatgacgaat
gcaccttatattttgcctaaagctcgcggtggttatcgtatgggacacggcgaaattaag
gaccatatgtttttagatggcctcgaagatgcagaaactggtcgtttaatgggatctttt
gctcaagacatggcaaataccaaaggctttacccgtgagcaaatggatgactttgcaatt
tcttcacttaaaaaagcgcaaactgcgattacggaaggttatttcaaagaagagattgtt
cctgttgaagtaaaaacccgtaaaggtgttgaagttattgatcaagatgagcaaccatta
aaagcaaatcttgagaaaattccaactttacgccctgcttttagcaaggacggtacaatt
acagccgctaactcaagctcaatttctgatggtgctgctgcattagtacttaccactgaa
gaatatgctcaaagtcacgggttaaatactttagcaaaaattgtggcaacttcgactcac
tctcagcatccaagcgaattcacaattgctccaattagtgcaattcaaaaagtacttgag
cgtgctggttggtctgttgatgaagtagatgcttgggaaattaatgaggcttttgcaatg
gtggcaatggcaccaattcatgagctaggaattgatgaagcaaaagtaaacgtccatggt
ggtgcatgtgcattaggccatccaattggtgctacaggttcaagaattatcctttctctt
atttatgcattaaaacgcttaggtaaaaagaaaggtgtcgctgccctatgtattggtggt
ggtgaagcaacagccgttgcgattgaaatttaa

DBGET integrated database retrieval system