KEGG   Acinetobacter baumannii ATCC 17978: A1S_2248Help
Entry
A1S_2248          CDS       T00486                                 

Definition
(GenBank) 2-keto-D-gluconate reductase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb00030  Pentose phosphate pathway
acb00260  Glycine, serine and threonine metabolism
acb00620  Pyruvate metabolism
acb00630  Glyoxylate and dicarboxylate metabolism
acb01100  Metabolic pathways
acb01110  Biosynthesis of secondary metabolites
acb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A1S_2248
   00620 Pyruvate metabolism
    A1S_2248
   00630 Glyoxylate and dicarboxylate metabolism
    A1S_2248
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A1S_2248
Enzymes [BR:acb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     A1S_2248
    1.1.1.81  hydroxypyruvate reductase
     A1S_2248
    1.1.1.215  gluconate 2-dehydrogenase
     A1S_2248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored NAD_binding_2 AlaDh_PNT_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABO12671
Position
complement(2609512..2610477)
Genome map
AA seq 321 aa AA seqDB search
MKKVVVFSQIDEEILSRLQQDYHVVVLNPKLGDINEQIRQEVVDADGMIGAGRLLNESNL
SPAQKLKIISSVTVGYDNYDVGYLNQKKIWLANTPHVLTETTADLAFTLLLSAARKVPLL
DHWTKQGEWKRTVGPQQFGLDVFGKTLGIIGLGNIGAAIARRGFYGFNMNIVYHNRREKP
ELAEPLKAQYLGLEELLQQSDFVVTAVDLNAESKALMGKAQFELMQKHAIFINIARGSVV
DEQALIEALQNEVIFAAGLDVYEKEPLQESALFTLPNVVTLPHVGSATAETRKKMANLAY
KNLVEALEDKTPRYLVNPNFV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggttgtggtttttagccaaattgatgaggaaattttgtcacggttacagcag
gattaccatgttgtcgtattgaaccctaaactgggtgatattaatgaacagatacgacaa
gaagtagtagatgctgatggcatgattggggctggtcgtttgctcaatgaaagtaatctt
tctcctgcccaaaaattaaaaattatttcttctgtgactgtaggttatgacaattatgat
gttggttatttaaatcagaaaaaaatctggttagcaaacacacctcatgttctaactgaa
acgacagcagatcttgcttttactttgttattaagtgcagccagaaaagttcctttgcta
gatcactggactaaacaaggtgagtggaaaagaacagttgggccacagcagtttggtctc
gatgtttttggaaaaacattaggtattattgggcttggtaatattggtgctgcaattgca
cgtcgtggcttttatggatttaacatgaatattgtttaccataatcgtcgcgagaaacct
gagttagcggaacctttaaaagctcaatatctggggttggaagaattattacaacaatct
gattttgtagtgacggctgttgatttaaatgcggaatctaaagctttaatgggtaaggct
caatttgagcttatgcaaaagcatgccatatttattaatattgcgcgtggctcagttgtc
gatgagcaagccctaattgaagcattgcaaaatgaagttatttttgcggctggtttagac
gtctatgagaaagaacctctgcaagaatctgcacttttcactttgccgaacgttgtcact
ttgcctcacgtaggttctgctactgctgaaacacgtaagaaaatggcaaatttagcttat
aaaaacttggtggaagcactagaggacaagacgcctagatatttagtgaatcctaatttt
gtgtaa

DBGET integrated database retrieval system