KEGG   Acinetobacter baumannii ATCC 17978: A1S_2637Help
Entry
A1S_2637          CDS       T00486                                 

Definition
(GenBank) erythronate-4-phosphate dehydrogenase
  KO
K03473  erythronate-4-phosphate dehydrogenase [EC:1.1.1.290]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb00750  Vitamin B6 metabolism
acb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A1S_2637
Enzymes [BR:acb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.290  4-phosphoerythronate dehydrogenase
     A1S_2637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh DUF3410 NAD_binding_2 XdhC_C
Motif
Other DBs
NCBI-ProteinID: ABO13054
UniProt: A3M810
Position
complement(3052558..3053625)
Genome map
AA seq 355 aa AA seqDB search
MKIVADENLAFTDYFFSEFGDIQHKAGRTLTHTDVQDAEALLVRSVTAVNESLIQNTALK
YVGSATIGTDHLDIQALEKQGITWANAAGCNAQAVAEYVITALLHLDASLLEQQEKFTLG
IVGLGNVGKRLAYMAQLLGWKVIGFDPFVQLDSIENVSFQTLLQQANAVSIHVPLTKKGE
HATYHLFDEKAFAALQPNTILINSARGPVVKEAALIEDIQRTQRKVVLDVFEHEPVISEE
LLNMLALATPHIAGYSLEGKARGTQMIYEAFCQKFGYDINKRFETQLPACEDYFSRHDLK
AVLKQKISQIYDIAQDDANIRACVKEGKVEQKAFDLLRKNYPLRREWAAHGGPQA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgtcgcagatgaaaatttggcgtttaccgattactttttttcagagtttggc
gatattcaacataaagcagggcgcaccttaacgcatacagacgtacaagatgctgaagct
ttattggttcgttcagtcaccgcagtaaatgaaagtttaattcaaaataccgccctaaaa
tatgtgggcagtgccacaatcgggaccgatcatttagatattcaagctttagaaaagcag
ggcattacatgggccaatgccgcgggttgtaatgcacaggcggttgctgaatatgtgatt
acagctttactgcatttagatgctagccttttagaacaacaagaaaaatttacgctaggt
attgtgggtcttggcaatgttggtaagcgcttggcctatatggctcagttgcttggttgg
aaagtgattggctttgacccctttgtacagttagattcaattgaaaatgtaagctttcaa
accttgttgcaacaagctaatgcagtttcaattcatgtaccgctgaccaaaaaaggcgaa
catgcgacgtatcatctgtttgacgaaaaagcttttgcagcgcttcaaccgaacacgatt
ttaattaatagtgcacgtggtccggtcgtaaaagaagccgctttaatcgaagacattcaa
cgtacccagcgtaaagtggtgctcgatgtatttgagcatgagccagtgatatctgaagag
cttttaaatatgttggctttggcgacaccgcatattgctggttatagccttgaaggaaaa
gcccgcggtacccaaatgatttatgaagcgttttgccaaaaatttggatatgacattaat
aagcgttttgaaactcagttacctgcatgtgaagactatttttcaagacatgatttaaaa
gcagtgttaaagcaaaaaatatctcaaatttatgatattgctcaagatgatgccaacatc
cgtgcctgtgttaaagagggcaaggtagagcaaaaagcatttgatttattacgtaagaat
tatccgctgcgccgtgaatgggcagctcacgggggaccacaggcatga

DBGET integrated database retrieval system