KEGG   Acinetobacter baumannii ATCC 17978: A1S_2716Help
Entry
A1S_2716          CDS       T00486                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (E2)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb00020  Citrate cycle (TCA cycle)
acb00310  Lysine degradation
acb00380  Tryptophan metabolism
acb01100  Metabolic pathways
acb01110  Biosynthesis of secondary metabolites
acb01120  Microbial metabolism in diverse environments
acb01130  Biosynthesis of antibiotics
acb01200  Carbon metabolism
Module
acb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1S_2716
  09105 Amino acid metabolism
   00310 Lysine degradation
    A1S_2716
   00380 Tryptophan metabolism
    A1S_2716
Enzymes [BR:acb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     A1S_2716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF5304 GCV_H OmpA
Motif
Other DBs
NCBI-ProteinID: ABO13129
Position
3151571..3152767
Genome map
AA seq 398 aa AA seqDB search
MATEIKAPVFPESVADGTIATWHKKVGEPVSRDEVICDIETDKVVLEVVAPADGSLVAII
KGEGDTVLSDEVIAQFEAGAGAAAAAPAAVEQAVAQTQAGAAPVVERNETVSDQAPAVRK
ALTESGIAASDVQGTGRGGRITKEDVANHQAKPAANVTPLSVAVGERIEKRVPMTRLRKR
VAERLLAATQETAMLTTFNEVNMKPIMELRKQYKDAFEKRHGARLGFMSFFVKAATEALK
RYPAVNASIDGDDIVYHGYYDIGVAVSSDRGLVVPVLRDTDRMSYAEVEAGIAAYAAKAR
DGKLSIEEMTGGTFTITNGGTFGSLLSTPILNQPQTGILGMHKIQERPMAVNGQVEILPM
MYLALSYDHRMIDGKEAVGFLVAIKELLEEPAKLILDL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaaattaaagcaccggtattcccagagtctgttgcagatggaaccatcgca
acttggcataaaaaggtgggtgaacctgtatcacgtgatgaagtaatctgtgatattgaa
accgacaaagttgttttagaagttgttgctcctgcagatggtagcttggttgcaatcatt
aaaggtgaaggcgatacagttctttctgacgaagttattgctcaattcgaagctggtgct
ggcgcagcggctgctgctcctgcggcagtagaacaagcagttgctcagactcaagctggt
gctgctcctgttgttgagcgtaacgaaactgtatctgatcaagctcctgcagtacgtaaa
gcgttaactgaatctggcattgctgcttctgacgtacaaggtactggtcgtggtggtcgt
atcactaaagaagatgttgcgaaccatcaagctaaaccagctgctaacgttactccatta
agcgttgctgttggcgaacgtatcgaaaaacgcgttccaatgactcgtttacgtaaacgt
gtagctgagcgtcttcttgcagctactcaagaaacagcaatgttaactacatttaacgaa
gttaacatgaagccaatcatggaattacgtaagcaatataaagatgctttcgaaaaacgt
catggtgctcgtttaggcttcatgtcattcttcgttaaagcagcaactgaagcgcttaaa
cgctacccagctgtaaatgcttcaattgatggcgatgatatcgtttatcacggttactac
gacatcggtgttgcagtatcttctgatcgtggtcttgttgtaccagtattacgtgatact
gaccgtatgagctatgcagaagttgaagcaggtattgctgcttacgctgctaaagcacgt
gatggtaaattatctatcgaagaaatgactggcggtactttcacaatcactaacggtggt
actttcggttcattactttcaactccaattttgaaccagccgcaaactggtatcttgggt
atgcataaaatccaagaacgtcctatggcggtaaatggtcaagttgaaatcttgccaatg
atgtacttagcgctttcttatgaccaccgtatgatcgatggtaaagaagctgtaggtttc
ttagtagcaatcaaagaattgttagaagaaccagctaaactcattcttgatctttaa

DBGET integrated database retrieval system