KEGG   Acinetobacter pittii: BDGL_000382Help
Entry
BDGL_000382       CDS       T01684                                 

Gene name
aldH
Definition
(RefSeq) 2-ketoglutarate semialdehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
acc  Acinetobacter pittii
Pathway
acc00040  Pentose and glucuronate interconversions
acc00053  Ascorbate and aldarate metabolism
acc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BDGL_000382 (aldH)
   00053 Ascorbate and aldarate metabolism
    BDGL_000382 (aldH)
Enzymes [BR:acc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     BDGL_000382 (aldH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 11638560
NCBI-ProteinID: YP_004994650
UniProt: F0KHM0
Position
413471..415057
Genome map
AA seq 528 aa AA seqDB search
MSKNNGRQFINGERVAANAPALESIGAKDYQPTGCVFSQATLEEVDQAAQAAHNAFLVYS
QTTQEHRASFLEEIARQIEALGANLQEVASLETGLPLARLQGETGRVTGQLRLFAELLRR
GDFYGARIDVALPERKPLPRVDLRQYKVGVGPVAVFGASNFPLAFSTAGGDTVAALAAGC
PVVFKAHSGHMATAELVAEAIEKAIEVCDMPKGTFNMIFGGRIGANLVEHPLIQAAGFTG
SLEGGMALYNLAQSRPQPIPFFAEMSSVNPVVVLSQALSSRGEQIAQDTVASFNMGCGQF
CTKPGLILGVQGPEFDSFVAALAESTQKAVPQVMLNEGTLKSYRQGIDALNSEAGFKVIA
TGQEAELVSQAKAHLFKADQSVLLSGNPKLQHEVFGPMSIVIGVEDKATLLKGIESLGGQ
LTATIIGDENELSEAGELLHLLTGKAGRVLFNGFPTGVEVSDAMVHGGPFPATSDARGTS
VGTGAIERFLRPVCFQNTPQVLLPDALKDSNPLQITRLVNGQLTQAQI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaataacggtcggcagtttattaatggcgaacgcgttgctgcaaatgcacca
gctttagaaagtataggtgcaaaagactatcagccaacaggttgtgtatttagtcaggca
acacttgaagaagtagatcaggctgctcaagctgcgcataacgcttttttagtttatagc
caaacgactcaagaacaccgtgcatcttttcttgaagaaattgctcgccaaattgaagca
ttgggggcgaacttgcaggaggttgcttcacttgaaacaggtttgccacttgctcgtctt
caaggggagacagggcgggttactggccagctaagactatttgctgaacttttacgccgc
ggcgatttttatggtgcccgtattgatgtggcattgccagaacgtaagcctttaccgcgt
gtcgatttgcgtcagtataaagttggggtaggaccggttgctgtatttggcgcgagtaat
ttcccacttgcattttcaactgcaggcggtgataccgtagctgctttagcagcagggtgt
ccggttgtctttaaagcacactctggccatatggcaactgctgagcttgttgcagaagcc
attgaaaaagcaattgaagtttgtgatatgcctaaaggcacatttaatatgatttttggt
ggccgtattggagcaaacttggtagaacatccactgattcaggcagctggttttacgggt
tctcttgaaggcggaatggcactttataaccttgcgcagagccgtcctcagccaattcca
ttctttgctgaaatgtcgagtgtgaaccctgtagtggttttatctcaagcgctgagttct
cgtggtgaacaaattgctcaggatacggttgcttcattcaatatgggatgtggccagttc
tgtacaaaaccggggttaattttaggcgtacaaggtcctgaatttgacagtttcgtagca
gctttagctgaaagcacgcaaaaagctgtgcctcaggtcatgctgaatgaaggaacttta
aaaagttaccgtcaaggtattgatgctctaaacagtgaagctggttttaaagttattgcg
acaggacaagaggccgagctagtttctcaagcaaaagcacatctatttaaagcggatcaa
tctgttttattgtcaggcaacccaaaactacaacatgaagttttcgggccaatgtcgatt
gtgattggcgtagaagataaagcgactttgttaaaagggatcgagtctttaggtggacag
ctcacggcaaccattattggtgatgaaaatgagttgtctgaagcaggcgagcttcttcat
ttgctaaccggtaaagctggccgtgtattgtttaacggtttcccgacaggagttgaagtg
tctgatgccatggtacatggtggtcctttccctgcaaccagtgatgcacgcggaacttcg
gtgggtacgggagcgattgagcgtttcttgcgtccggtatgtttccaaaatacaccacaa
gttttattacccgatgcattaaaagatagtaatccactacagattactcgtctggtcaat
gggcaattaactcaggctcaaatttaa

DBGET integrated database retrieval system