KEGG   Acinetobacter pittii: BDGL_000632
Entry
BDGL_000632       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
acc  Acinetobacter pittii
Pathway
acc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BDGL_000632
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acc02044]
    BDGL_000632
Secretion system [BR:acc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BDGL_000632
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1
Other DBs
NCBI-GeneID: 11638812
NCBI-ProteinID: YP_004994900
UniProt: F0KJN9
Position
662712..665282
AA seq 856 aa
MLHVQFSNPSLNTQVFLQSIEGQHQLNEGLTADLFCLSTNAHISLKQFIGCQVAVDQVTD
QGQLFRTTGIITEASQGQSDGSLTLYKLRLQDPTALWHKRRNSRVFMNKSVRDITEILFT
EWQNKSPLFTSGLTLDLKGLTEDYDVRPFIMQSNETDYEFLTRLWRSEGINWLVDEAQLF
VTHSSVEIQSQKLRLIDNNESYLALDRRNIRYHRSSAVEQQDSMISLVPTRSLQSTAVHV
QRWQADALSQEEGMGSVQSKHSHSANQDNASLSLEHAWHVSPAWMQDLKGEDQATASGHQ
QLEKLNNNLSDYYASQSKYFRAQTTVRDAQVGYWFELNEHPEIDTHSGSDKEFLIIGKSF
YLQNNLPKDLQQQINQLFSQSQWQNNQSGPNDQTERQGNELILSRRNIKTVPEYNPFEHR
PAAYPQRARVVGLEGESIHVDQWGRIKVRFLFTRTDDHSHDGGAGSNDNDTDSAWVDVLT
PWAGAGYGARFLPRVGEIVVIDFFDGNIDRPFVVGRIHEAERHPTQFDQKGQLPDTKKLS
GIRSEEVDGKGFNQLRFDDTTGQISAQLQSSHAASQLNLGNLSHPKDKAESDSRGEGFEL
RTDQWGAVRAGSGLLLSTHKQDQAQGVHLNANETKQQIEGGLNNAKALSEVAKNQQTDPL
DMLENIQTFLEVLKQEDPKKAAEFQSAVMLLASPKSIAVSSNEDIHLSANGQLTQSAGDS
INISTQKNIVSHASQKISLFAAQEGARIFAGQGKLEIQAQGDGLDVIARKGVQITSTEDT
VFITSPTEINLTVSGSQVKLNGSGIFPVTGGKLEVKAGQHLFMGGSSINPPALDLPDCSA
KQTQAAQNGSAKVILD
NT seq 2571 nt   +upstreamnt  +downstreamnt
gtgcttcatgttcagttttctaatccatcgttgaatactcaagtctttttacaaagtatt
gaaggacagcatcagctaaatgaaggactgactgccgatttattttgtctttctaccaat
gcccatatttcattaaaacaatttattggttgtcaggttgcagtcgatcaagtcactgat
caggggcagctatttagaactacaggaattattacagaagccagtcaggggcagagtgat
ggttcattaacattgtataaactgagattgcaagatccaaccgcactatggcataaacgc
cgcaatagtcgtgtgtttatgaataagagtgtacgggacattactgaaattctatttaca
gaatggcagaacaaaagccccttgtttacttctggtttaacattggatttaaaaggtcta
accgaagactacgatgttcgaccttttatcatgcaaagtaatgaaacggattatgaattt
ttaacccgactttggcgtagtgaaggtattaactggttagttgatgaagctcagttgttt
gtcactcatagctcagttgagattcaatcacaaaagttacgtttaattgataataatgaa
tcatatttagcattagaccgaagaaatatccgttatcaccgtagtagcgctgttgaacaa
caagacagtatgataagccttgtgccaactcgaagcttgcaatctacagccgtgcatgta
caacgctggcaggctgatgctttaagtcaagaagaaggcatgggcagtgttcagtcaaag
catagtcatagtgctaatcaggataatgcaagtttaagtctagaacatgcatggcatgtc
agccctgcttggatgcaagatttaaaaggtgaagatcaagctaccgcatcgggtcaccag
cagctagaaaaactcaacaataatctatctgattattatgcgtctcaatcaaaatatttc
cgtgcacaaactacggtacgtgatgcgcaagttggctattggtttgaattgaatgaacat
ccagaaatagatacgcatagtggatcagacaaagaatttctgattattggtaaaagcttc
tatttacaaaataatttgcctaaagatttacaacagcaaatcaatcaactttttagtcaa
agccaatggcaaaacaatcaatcagggccaaatgaccagactgagcgtcagggtaatgag
ctcatcttatcgcgtagaaatataaaaactgttcctgagtataacccgtttgaacatcga
ccagccgcttacccgcagcgcgctagagtggttggattagagggtgaaagtattcatgtt
gaccagtggggacgcataaaagtccgcttcctgtttacccgaacagatgaccacagccat
gatggtggagcaggtagtaacgacaatgacactgactcagcttgggttgatgtgctgact
ccatgggcaggtgcaggttatggtgcacgcttcttacctcgcgtgggtgagattgttgtt
atcgacttctttgacggcaacattgaccgtccatttgtggtggggcgtattcacgaagct
gaacgccatccaacccagttcgaccagaaaggtcagctccccgacactaaaaaacttagc
ggcatccgctcagaagaagtcgacggtaaaggctttaaccagctacgttttgatgacact
acaggccagatcagtgcccagctgcaaagcagccatgccgcaagccaactaaacttgggt
aacttaagccatccaaaagacaaggcggaaagtgatagtcgtggtgaaggtttcgagcta
cgaacagaccagtggggggcagtcagagcaggcagcggcttactccttagtacccacaaa
caggatcaagctcaaggcgtacacctcaatgcaaatgagaccaaacaacaaatagaaggt
ggcctcaacaatgccaaggcactcagtgaagttgctaaaaatcagcaaaccgacccgtta
gatatgcttgagaatattcagactttcttagaagttctcaaacaagaagatcctaaaaag
gctgctgagtttcaatcagcagtgatgctgctggcatctccaaaaagtattgctgtaagt
agtaatgaagatatacaccttagtgcaaatggtcagctcactcaaagtgctggagatagt
attaatattagtacgcaaaagaatatagtgagtcatgcgagtcaaaaaataagtctattt
gccgcccaagaaggtgctcggatttttgctggtcaaggtaaactagaaattcaggcacaa
ggtgatggcttagatgtgattgctcgaaagggcgtacaaattacttcaactgaagacacg
gtttttattactagcccaactgaaattaatctgactgtaagtggatctcaagttaagttg
aatggttcgggtattttccctgttacgggcggtaagcttgaggtgaaagcagggcagcat
ttgtttatgggaggatcatcaataaatccacctgcattagatttaccagactgttctgct
aaacagactcaagctgctcaaaatggatcagcaaaagtgatattagactaa

DBGET integrated database retrieval system