KEGG   Acinetobacter pittii: BDGL_000639Help
Entry
BDGL_000639       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
acc  Acinetobacter pittii
Brite
KEGG Orthology (KO) [BR:acc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acc02044]
    BDGL_000639
Secretion system [BR:acc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BDGL_000639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA DUF29
Motif
Other DBs
NCBI-GeneID: 11638819
NCBI-ProteinID: YP_004994907
UniProt: F0KJP6
Position
672832..673335
Genome map
AA seq 167 aa AA seqDB search
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDK
KFINVDLDNIDEVMESLSPRAAFQVDNTLTEEGGKIAVDLTFKSMEDFRPENVVQQVDPL
KKLVEARERLTDLRNKISNSERLEDLLDEVLKNTDQIRKLSAEADHE
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggctaagagagagagcgtacaaaagaagcttcagcgaattcgacctccacgtgttcag
cttacatatgatgtcgaaattggtgatgcaaaagaagcgaaagaactaccattcgttgtg
ggtgtgatgggtgatttttcggctgcatctgagcttgagcgtacaaaattaaaagataaa
aaattcattaatgttgatttagataatattgatgaagttatggagtcattgtctccaaga
gctgctttccaagtagataatacattgacagaagagggtggtaagatcgctgttgattta
acatttaagtcaatggaagattttcgtccagaaaacgtggttcaacaggttgatccatta
aagaaacttgtggaagctcgtgagcgtttaactgacttaagaaacaaaatttctaatagt
gaacgtttagaagacttacttgatgaagttcttaaaaatacagatcagattcgtaaatta
agtgcggaggctgatcatgaataa

DBGET integrated database retrieval system