KEGG   Acinetobacter pittii: BDGL_000641
Entry
BDGL_000641       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
acc  Acinetobacter pittii
Pathway
acc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BDGL_000641
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acc02044]
    BDGL_000641
Secretion system [BR:acc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BDGL_000641
SSDB
Motif
Pfam: T6SS_HCP DUF3880 FerB
Other DBs
NCBI-GeneID: 11638821
NCBI-ProteinID: YP_004994909
UniProt: F0KJP8
Position
674859..675362
AA seq 167 aa
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDM
VFVKDLDATSPKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNE
EGVPTEAFGLKYAAVEWTYNQQDINGTAKGAVTKKWSLSNNTASYAA
NT seq 504 nt   +upstreamnt  +downstreamnt
atgaaagatatatacgttgagtttcgcggtaaatataaagttgatggagagtctcgtgac
tctgagcacaaaggctggttagaagttaactcttggtctcataacattcgtcaacctaaa
tctgctacttcaagtagtgttggtggtcatactgctgaacgtgttgaacattcagatatg
gtttttgttaaagatctagatgcaactagcccgaaattatgggaagcatgttcagctggt
tatacatttgatgaagtacaaattgacttctaccgtgcaaatggtgataagcgcatcaag
tacttacaaatcaaattgaagcatgttctagtttcgagtgtaactccaacagttaatgaa
gaaggtgttccaacagaagcgtttggtttgaaatacgcagctgttgaatggacttacaat
caacaagatattaacggtactgctaaaggtgctgttactaagaaatggtcactttctaac
aatactgcttcttacgcagcgtaa

DBGET integrated database retrieval system