KEGG   Acinetobacter pittii: BDGL_000648
Entry
BDGL_000648       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
Organism
acc  Acinetobacter pittii
SSDB
Motif
Pfam: IcmF_C DUF5613
Other DBs
NCBI-GeneID: 11638828
NCBI-ProteinID: YP_004994916
UniProt: F0KK59
Position
683357..683920
AA seq 187 aa
MATGELNAQAQAAPATNQSNFQFYPIPNPQLLSYTVDIDGQRMTYENGVQQWVNFIWPNQ
GSIPGARITAVDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGGFEMLWRSKTDPSLFVK
MNFRLISSNSGSIGSSRGYAGMQLVDKVTADKAARVVSAQQAPAQAAPARTENPVSALAQ
SSAGVKP
NT seq 564 nt   +upstreamnt  +downstreamnt
atggcaactggtgagttgaatgctcaagcgcaagctgctccagcgactaaccaatctaac
ttccagttctacccaattccaaacccacaattgctttcatataccgttgatattgatggt
cagcgtatgacttatgaaaatggtgttcagcaatgggttaacttcatttggccaaaccaa
ggcagtattccaggtgctcgtattaccgctgtagatttacaaggccaaacccacacgatt
tttgatgagccaggtgagtacggtattaaccgtttaattgatagtgctcaacgtaaagaa
caaaatggcggatttgaaatgctttggcgtagtaaaactgatccatcattatttgtaaaa
atgaatttccgtctaattagcagtaattcaggcagtattggttcaagccgtggttatgca
ggtatgcaactggttgataaagtcactgccgacaaagcagctcgtgtggtgtctgctcag
caagcgccagctcaagctgctccagcaagaactgaaaatcctgtttcagcacttgctcag
tcttctgcgggagttaaaccatga

DBGET integrated database retrieval system