KEGG   Acinetobacter pittii: BDGL_000732Help
Entry
BDGL_000732       CDS       T01684                                 

Gene name
dcaF
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acc  Acinetobacter pittii
Pathway
acc00071  Fatty acid degradation
acc00072  Synthesis and degradation of ketone bodies
acc00280  Valine, leucine and isoleucine degradation
acc00310  Lysine degradation
acc00362  Benzoate degradation
acc00380  Tryptophan metabolism
acc00620  Pyruvate metabolism
acc00630  Glyoxylate and dicarboxylate metabolism
acc00640  Propanoate metabolism
acc00650  Butanoate metabolism
acc00900  Terpenoid backbone biosynthesis
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01120  Microbial metabolism in diverse environments
acc01130  Biosynthesis of antibiotics
acc01200  Carbon metabolism
acc01212  Fatty acid metabolism
acc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BDGL_000732 (dcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    BDGL_000732 (dcaF)
   00640 Propanoate metabolism
    BDGL_000732 (dcaF)
   00650 Butanoate metabolism
    BDGL_000732 (dcaF)
  Lipid metabolism
   00071 Fatty acid degradation
    BDGL_000732 (dcaF)
   00072 Synthesis and degradation of ketone bodies
    BDGL_000732 (dcaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BDGL_000732 (dcaF)
   00310 Lysine degradation
    BDGL_000732 (dcaF)
   00380 Tryptophan metabolism
    BDGL_000732 (dcaF)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BDGL_000732 (dcaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BDGL_000732 (dcaF)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BDGL_000732 (dcaF)
Enzymes [BR:acc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BDGL_000732 (dcaF)
Exosome [BR:acc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BDGL_000732 (dcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-GeneID: 11638912
NCBI-ProteinID: YP_004995000
UniProt: F0KKU7
Position
complement(773232..774437)
Genome map
AA seq 401 aa AA seqDB search
MLNAYIYDGLRSPFGRHAGELASIRPDDLAATVIQKLLEKTGVPGADIEDVILGDTNQAG
EDSRNVARNALLLAGLPVTVPGQTVNRLCASGLGAVIDSARAITCGEGELYIAGGVESMS
RAPFVMGKAESAYSRDAKIYDTTIGSRFPNKKIIAQYGGHSMPETGDNVAAEFGISREQA
DLFAAQSQAKYQKAKEEGFFADEITPIEVFQGKKLPPKLVSEDEHPRPSSTVEALTKLKP
LFEGGVVTAGNASGINDGAAALLIGSEAAGQKYGLKPMAKILSAAAAGIEPRIMGAGPIE
AIKKAVARAELTLDDMDIIEINEAFASQVLSCLKGLNVDFNDPRVNPNGGAIAVGHPLGA
SGARLSLTVARELIRRKKKYAVVSLCIGVGQGLAMVIENVS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgcatatatctatgatggtttgcgtagcccatttggccgccatgcaggtgaa
cttgcctcaattcgccctgatgatttagccgcaactgtcattcaaaaactattagaaaaa
actggtgttccgggtgctgatattgaagatgtgattttaggcgacaccaaccaagcgggt
gaagatagccgtaatgtggcacgaaatgctctattacttgcgggtttaccagtcactgta
ccgggccagacagtaaaccgcctatgtgctagtggtttaggtgccgtgattgactcagca
cgtgccattacttgtggtgaaggagaactgtatattgcaggtggtgtagaaagtatgtca
cgtgctccctttgtgatgggtaaagcagaaagtgcttatagccgtgatgcaaaaatttat
gacaccacaattggctctcgttttccaaataaaaaaattattgctcagtacggcggtcat
tcaatgcctgaaacaggtgataacgtcgcagccgagtttgggattagtcgtgagcaagca
gacttatttgcagcccaatcacaagccaaatatcaaaaagccaaagaagaaggtttcttt
gccgatgaaattacgccaattgaggtcttccaaggcaaaaaattacctcctaaactcgtt
tctgaagatgaacaccctcgcccaagttcaactgttgaagcactcacaaagttaaaacca
ctctttgaaggtggcgtggtcactgctggtaatgcctcaggtattaatgatggtgcagca
gccctattgattggttcagaagcagcaggtcaaaaatatggcctaaaaccaatggcaaaa
atcttgtcagccgccgccgctggtattgagccacgcattatgggtgcaggcccgattgaa
gccattaaaaaagcagttgcgcgtgcggagcttactttagatgacatggatattatcgaa
attaatgaagcttttgcttcacaggttttatcttgtttaaaaggtttaaatgttgatttt
aatgatccacgtgtgaacccgaacggtggtgcaattgcagttggtcatccacttggtgca
tctggtgctcgtcttagcttaacagtagctcgcgaacttatacgccgtaaaaagaaatat
gctgtggtgagcctctgtataggtgtaggccaaggtcttgcaatggtgattgaaaacgtt
tcataa

DBGET integrated database retrieval system