KEGG   Acinetobacter pittii: BDGL_000852Help
Entry
BDGL_000852       CDS       T01684                                 

Gene name
chpD
Definition
(RefSeq) AraC family transcriptional regulator, chemosensory pili system protein ChpD
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC HTH_11 HTH_24 HTH_AsnC-type Ad_Cy_reg Dimerisation HTH_26
Motif
Other DBs
NCBI-GeneID: 11639032
NCBI-ProteinID: YP_004995120
UniProt: F0KLM2
Position
904255..904695
Genome map
AA seq 146 aa AA seqDB search
MNETLFDPEKLIIEKEQSLIYCLTQLLLPHFVLQEIQKTEYLYEDFLDLIHIIKSSERFI
SLEELAEQVGLSRYAIIRLFKANVGLTPHAFQINLKINQARAQLKQGISLAELAVNLGFS
DQSHFHKAFKAHTGITPRQFQLAAAQ
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaactttatttgatcctgaaaaattaattattgaaaaagaacagtcgctgatc
tattgccttacccagctgttactccctcatttcgtattacaagaaatacaaaaaactgaa
tatttgtatgaagattttttggacttaattcatattattaaatcgtcagaacgatttatt
tctcttgaagagcttgcagagcaggttggtcttagtcgatatgcaatcattcgtttattc
aaggccaatgttggtttaactccacatgcatttcaaattaatttaaagattaatcaagcc
agagctcaattaaagcaagggatttcactcgcagagctagctgtcaatttaggctttagt
gatcaaagccattttcataaagcttttaaagcacatacgggaattactcctcgacagttt
caacttgcagccgcgcaataa

DBGET integrated database retrieval system