KEGG   Acinetobacter pittii: BDGL_000854Help
Entry
BDGL_000854       CDS       T01684                                 

Gene name
dapL
Definition
(RefSeq) putative aminotransferase
  KO
K14267  N-succinyldiaminopimelate aminotransferase [EC:2.6.1.17]
Organism
acc  Acinetobacter pittii
Pathway
acc00300  Lysine biosynthesis
acc01100  Metabolic pathways
acc01120  Microbial metabolism in diverse environments
acc01230  Biosynthesis of amino acids
Module
acc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:acc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BDGL_000854 (dapL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acc01007]
    BDGL_000854 (dapL)
Enzymes [BR:acc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.17  succinyldiaminopimelate transaminase
     BDGL_000854 (dapL)
Amino acid related enzymes [BR:acc01007]
 Aminotransferase (transaminase)
  Class I
   BDGL_000854 (dapL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Motif
Other DBs
NCBI-GeneID: 11639034
NCBI-ProteinID: YP_004995122
UniProt: F0KLM4
Position
complement(905447..906529)
Genome map
AA seq 360 aa AA seqDB search
MIPLSIGEPKHPAPEFVKQAIIDNFNHLSTYPNSKGLPELRQSISDWLTKRFKLNSISAE
NHILPVSGTREGIFSFVQALINREDAPYVVMPNPFYQIYEGAALLAGAKPYFINCTEENG
YLGDFDAVPAEVWEKTALLFVCTPGNPTGTVLSKEQFKKLIALSDQYNFVIASDECYSEL
WFDQAPTGLLEVCAELGRDDYKNCIVFHSLSKRSNLPGLRSGFVAGDADLLKPYLQYRTY
HGAAMPVQHQLASIAAWNDENHVEENRKQYRAKFDLFQSELGHLLPLQKPDAGFYYWLKV
DNDETFAKMLMEKAHIKVLPGRYLSRDTEQGNPGANHVRMALVADLAQCEEVVKRLKAIL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttgattcctctatcaattggcgaacctaagcatccagcaccagagtttgttaaacaggct
attattgataactttaaccatttatcaacttatccaaacagcaaaggcttaccagagctt
cgccaaagcatttcagattggttaactaagcgctttaaacttaacagcattagtgctgaa
aaccacatcttgcctgtctctggtacacgtgaagggattttctcttttgtacaggcatta
attaatcgtgaagatgcaccttatgtggtgatgccgaacccgttttatcaaatttatgaa
ggtgcagctttacttgcaggtgcaaagccatacttcattaattgcacggaagaaaatggc
tatttaggtgattttgatgctgtaccagcagaagtttgggaaaagacagcccttcttttt
gtgtgtacaccgggtaacccaacaggtactgtgctttccaaagaacaatttaaaaagcta
attgccttatctgatcaatataatttcgttattgcttctgatgaatgctattcagagctt
tggtttgaccaagcacctactggtctattagaagtttgtgctgagcttggtcgtgatgac
tacaaaaactgtatcgtatttcattcactttcaaagcgttcaaacttaccgggtttgcgc
tcaggttttgtagcgggtgatgccgatctgttaaagccatatttgcaataccgcacctat
cacggcgctgcaatgccagtacaacaccagcttgcttcaatcgcagcgtggaacgatgaa
aaccatgttgaagaaaaccgtaagcaatatcgtgcaaagtttgacttattccaatctgag
ctaggtcatttactgccattacaaaaacctgatgccggtttttattactggttaaaagtc
gataatgatgaaacttttgccaagatgctgatggaaaaagcacacattaaagttttaccg
ggtcgttatctatctcgtgataccgaacaaggtaaccctggtgccaatcatgtgcgtatg
gctttagtagcagatttggcacaatgtgaagaagttgttaaacgtttaaaagcgattctt
taa

DBGET integrated database retrieval system