KEGG   Acinetobacter pittii: BDGL_000855Help
Entry
BDGL_000855       CDS       T01684                                 

Gene name
glnD
Definition
(RefSeq) uridylyltransferase
  KO
K00990  [protein-PII] uridylyltransferase [EC:2.7.7.59]
Organism
acc  Acinetobacter pittii
Pathway
acc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BDGL_000855 (glnD)
Enzymes [BR:acc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.59  [protein-PII] uridylyltransferase
     BDGL_000855 (glnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnD_UR_UTase HD ACT NTP_transf_2 DUF294
Motif
Other DBs
NCBI-GeneID: 11639035
NCBI-ProteinID: YP_004995123
UniProt: F0KLM5
Position
complement(906642..909305)
Genome map
AA seq 887 aa AA seqDB search
MINISPLLNYVSSHHDIKAINQWRTDVEKQLQDSYENGQSIREIIKARSDLVDEALIFLW
KHAELDQTELGLFAVGGYGRREMLPYSDVDIMILSEHEINEENEKRISTFISSLWDVGNF
KPGISVRTIQSCVEQAATDLTVATTLIEARLITGNSQLAKWPRRIVSQTWTDKTFYDAKM
AEQAKRYHQHNNTESNLEPDIKNAPGGIRDINQIGWIAKRHFRVNRIYDLVHLGFISEFE
LAVLEEAESFLWEIRHHLHRLAKRDENRLLFDHQREIAAKFGYVRQEGQPVNYGVEQFMK
RYYRTAQQVSTLNEMLLAYFSESVITPRLPNYERKIEVVNDHFKIVDNKLAVQHHKIFAE
HPSAILELFYILANRPDIEGIRARTLRLLILAAKRINQSYRDNPEHQALFMSIIRSPYRL
YDTLVAMKRYGVLGNYIPAFGQIMGLMQYDLFHIYTVDAHTLLLLRNLNRFREPEFAKEF
PVVSSVFQRLARQDIVFIAALFHDIAKGRGGDHSELGAEDAIEFGRAHGFTERECKLIAW
LIQNHLLMSLTAQKKDISDPDVVKDFAEKLGDMEHLDYLYTLTVADINATNPKLWNTWRA
SLMRQLYTHARDVIRTGLGRPVDYQMLIEDTKFAASELLVNNFALADVEKVWQELGDEYF
IKESADEIAWHTQAILKHGDNPEPLVLLRAHRKAAQDAVQIFIYTRDQPNLFATTVAVLD
RMNLDVQDAKIITASTAFSLDTYVVLDRFGTLLTDPEREETVKNALVKALSQPDQYPGLM
QRRIPRQLRHFDIENTVDVTLNEALQQNMVEISTLDHPGLLARVGGLFMMQGLDIHSARI
ATLGERAEDIFFVTKKDGKPLNNEEVKLFSEKLKAALDEASNQICQH
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatatatcgccattgttgaactatgtctcaagtcatcatgatattaaagccatt
aatcaatggcgaacggatgtagaaaagcagttgcaagattcatatgaaaatgggcaatct
attcgtgaaatcattaaagcccgttcagatttagtagatgaagcactgatctttttatgg
aaacatgctgaactcgatcaaacagaactgggcctttttgctgtaggtggttatgggcgc
cgtgaaatgttgccctattctgacgtcgatatcatgatcctatcggagcatgaaattaac
gaagaaaacgaaaaacgtatctctacatttatttcttctttatgggacgtggggaatttc
aaacccggcattagtgttcgcacgattcaaagctgtgttgaacaggccgctaccgattta
accgttgcaacaactttaattgaagcacggttaattactggcaatagtcagcttgcgaaa
tggcctcgccgtattgtttctcagacatggacagacaaaacattttatgacgcaaaaatg
gccgaacaagccaagcgttaccatcaacacaacaatactgaaagtaatttagaacccgac
attaaaaatgcaccgggcggtattcgtgacattaaccaaattggctggatagccaaacgt
cactttcgcgtaaatcgtatttatgacttagtgcatttaggtttcatttcagagtttgaa
ttggcagttttagaagaagctgaaagttttctttgggaaattcgacatcatttacaccgt
ttagctaaacgtgatgaaaaccgtttactctttgaccatcaaagggaaattgccgctaaa
tttggttatgttcgtcaagaaggccaacctgtaaattatggtgttgagcaattcatgaaa
cgctactaccgtacggcgcagcaagtttcaacactcaatgaaatgttactggcgtatttt
agcgagtcagtgattacacctcgactgcccaactatgaacgcaaaattgaagttgttaac
gatcactttaaaattgtcgataataaacttgccgtacaacatcataaaatattcgccgag
catccaagcgcgattttagagttgttctatattttagccaatcgaccagatattgaaggt
attcgcgcccggactttacgcttacttattcttgccgcgaaacgaatcaaccaaagttat
cgcgataatccagagcatcaagcactgtttatgtcgattattcgctcaccatatcgttta
tacgataccttggttgcgatgaaacgatatggtgttttaggaaactatattcctgctttt
ggccaaattatgggccttatgcaatatgacttgttccatatctatacggtcgatgctcac
acattattattgctgcgtaatttaaatcgttttagagaaccagaatttgccaaagaattc
cctgtagtaagttcagttttccaacgtcttgctcgtcaagatattgtgttcattgctgct
ttattccatgacatcgcaaaaggtcgcggtggtgaccacagcgaactcggcgcagaagat
gcaattgagtttggccgtgcacatggctttacagagcgtgaatgtaaattaattgcatgg
cttattcaaaaccatttgctcatgtctttgaccgctcagaaaaaagatatttctgatcct
gatgtcgtgaaagattttgcagagaaactgggcgatatggagcatcttgattatctatat
accttaacggttgccgatattaacgcgacaaatccaaaactatggaacacatggcgcgct
tctctcatgcgtcaactttatacgcatgctcgtgatgtaatccgtacaggtttaggccgt
cccgttgactaccaaatgctgattgaagacaccaaatttgcagcaagtgaattgctggta
aataacttcgcattggcagatgtcgaaaaagtatggcaagaactaggtgatgaatacttc
attaaagaatcggcggatgaaattgcgtggcatacacaagcaattttaaaacatggtgat
aatccagagccattagtcctcttgcgtgctcaccgtaaagcagctcaagatgcggtgcaa
atctttatttatactcgcgatcaacctaacctatttgccaccaccgttgccgttttagac
cgaatgaacttagacgttcaggacgcaaaaattatcacggcaagtacagcatttagctta
gacacttatgttgtacttgatcgtttcgggacattgcttaccgacccagaacgtgaagaa
accgttaaaaatgcattagtgaaagcccttagccaaccagaccaatatccgggactcatg
caacgtcgtattccacgtcaattacgtcatttcgacattgaaaatacagtcgatgtaaca
ttaaatgaagccttacagcaaaatatggtcgaaatttcaacactcgatcaccccggccta
cttgcacgcgtgggtggtttatttatgatgcaaggtttagacatccattcagcccgaatc
gcaactttaggtgaacgtgccgaagatattttctttgtcaccaaaaaagatggaaaaccg
ctgaataacgaagaggtcaaactcttctcggaaaaactgaaagctgcattagatgaagca
tctaatcaaatttgtcagcactga

DBGET integrated database retrieval system