KEGG   Acinetobacter pittii: BDGL_000858Help
Entry
BDGL_000858       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AzlD DUF2053 DUF2723 DUF5337
Motif
Other DBs
NCBI-GeneID: 11639038
NCBI-ProteinID: YP_004995126
UniProt: F0KLM8
Position
complement(911173..911514)
Genome map
AA seq 113 aa AA seqDB search
MNLEIILVGIIVGIANFASRFGPFFVIQKLQGSQQRRGSIWIKIALGSIGISAISAMLVV
ATLPPLLETPNKSFAMLIGFLVLAGLYFKFKKIVPATLTAAIVYGLIYTYLPL
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaacctagaaattattctggtcggcattattgtgggtatagccaattttgcttcacgc
tttggaccttttttcgtaatacaaaaattacagggttcacagcaaagacgtggctcaatc
tggatcaaaattgccttagggagtattggaatatctgcaattagtgccatgcttgtagtt
gctactcttccacctctccttgaaactcccaataagagtttcgcaatgcttatcggtttt
ttagttttagcaggtctttattttaaatttaagaaaatcgtaccggcaactttaactgcc
gcaattgtttatggcctgatctatacttatttacctttataa

DBGET integrated database retrieval system