KEGG   Acinetobacter pittii: BDGL_000861Help
Entry
BDGL_000861       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4148
Motif
Other DBs
NCBI-GeneID: 11639041
NCBI-ProteinID: YP_004995129
UniProt: F0KLN1
Position
complement(912905..913240)
Genome map
AA seq 111 aa AA seqDB search
MKKLSTILTAGVLAMLSVSAFACPKGTQLQGGTGPNHKGGKCVAVHGKATAQKAKKEVTK
TKQDVKKDLSTQKHNAMTSATHSQHESQQMTHQMKQDAVKTANTAKAATKS
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattatcaacaattcttacagcaggcgtattggctatgttaagtgtttcggca
tttgcatgtccaaaagggactcaactacaaggcggtacaggaccaaatcacaaaggtgga
aaatgtgtagcggtacatggaaaagctaccgctcaaaaagccaagaaagaggtaactaaa
actaaacaggatgttaaaaaagacttaagcactcaaaaacataatgcaatgaccagcgcg
actcattctcaacatgaatcacagcaaatgactcatcaaatgaaacaagatgctgtgaag
actgcaaacaccgctaaagctgccacaaaatcgtaa

DBGET integrated database retrieval system