KEGG   Acinetobacter pittii: BDGL_000863Help
Entry
BDGL_000863       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF962 FUSC HlyIII
Motif
Other DBs
NCBI-GeneID: 11639043
NCBI-ProteinID: YP_004995131
UniProt: F0KLN3
Position
914212..914733
Genome map
AA seq 173 aa AA seqDB search
MSNLEQELSKYAAYHLNHKNILTHFIGIPLIVFSILCLTARAGVDIGSFKLTLAIVLIVA
STIYYLLLDKIFGLLMLIILFAVYPLASQIAQLSLGEWLAASIGFFVVGWVFQFVGHYFE
KKKPAFVDDVIGLAIGPLFVLAEFIFMLGFRKPLHARILQEACSKREAMDLSH
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatctggagcaagagcttagcaaatatgcggcttaccacttaaatcataaaaat
attttgacgcattttatcggtattccgctcatcgtgttttcaattttgtgtttaaccgca
agagctggagtcgatattggtagttttaagcttactttagccatagtgctgattgtagct
agtacgatttattatttattgctagataaaatttttggtttactcatgctcattatcttg
tttgctgtgtatccactagcgagccaaattgctcaattgtctttaggagaatggttagca
gcaagtattggcttctttgttgtcggttgggtctttcagtttgtgggacattattttgaa
aagaaaaaaccggcttttgttgatgatgtgattggacttgcgatagggccgttatttgta
ttggcagaatttatatttatgctaggttttagaaagcctttgcatgcacgtattttacaa
gaggcgtgcagtaaacgagaggcgatggatttaagtcattaa

DBGET integrated database retrieval system