KEGG   Acinetobacter pittii: BDGL_000864Help
Entry
BDGL_000864       CDS       T01684                                 

Gene name
ychF
Definition
(RefSeq) translation-associated GTPase
  KO
K06942  ribosome-binding ATPase
Organism
acc  Acinetobacter pittii
Brite
KEGG Orthology (KO) [BR:acc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:acc03009]
    BDGL_000864 (ychF)
Ribosome biogenesis [BR:acc03009]
 Prokaryotic Type
  Other maturation factors
   BDGL_000864 (ychF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YchF-GTPase_C MMR_HSR1 FeoB_N TGS
Motif
Other DBs
NCBI-GeneID: 11639044
NCBI-ProteinID: YP_004995132
UniProt: F0KLN4
Position
complement(914777..915868)
Genome map
AA seq 363 aa AA seqDB search
MGFNCGIVGLPNVGKSTLFNALTKAAIAAENFPFCTIEPNTGIVPVPDPRLDKLAAIVKP
QRILPTTMEFVDIAGLVAGASKGEGLGNQFLANIRETDAIAHVVRCFEDENVIHVNGKID
PLDDIATINTELALADLETVAKAILRLTKVAKGGDKEAVATKAVLEKIQPLLDEGKPARA
ADLSDDERKLVRGFGLMTLKPTMYIANVAEDGFENNPHLEAVKKLAAEENAIVVPLCNQI
EAEISLLEDEDRAEFLEAMGMEEPGLNVVIRAGYALLGLQTYFTAGVQEVRAWTVKVGAT
APQAAGVIHTDFEKGFIRAEVVAYDDFVQYNGENGAKEAGKWRLEGKTYVVQDGDVMHFR
FNV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggttttaattgcggtattgttggtctgccaaacgtagggaaatctacccttttcaat
gcattaacgaaagcagcgattgcagcggaaaacttccctttctgtaccattgaaccaaac
acaggtattgttcctgtaccagatccacgtttagacaaacttgctgcgattgttaaacca
cagcgtattttgccaactacaatggaatttgtggacattgcaggtcttgttgctggtgca
tcaaaaggtgaaggcttaggtaaccaattccttgctaacatccgtgaaactgatgcaatc
gctcatgttgtacgttgtttcgaagacgaaaacgtgattcacgtaaatggtaaaattgat
ccattagacgacatcgcaactattaatactgaacttgcgcttgccgatcttgaaactgtt
gctaaagcaattttacgtttaactaaagttgctaaaggtggtgacaaagaagctgtagca
actaaagcagttttagaaaaaatccaaccgttacttgacgaaggtaaaccagcgcgtgca
gctgatttgtctgatgacgaacgcaaattagttcgtggttttggtttaatgactttaaaa
ccaaccatgtatattgcaaacgttgcagaagacggttttgaaaacaacccacacttagaa
gctgttaaaaaacttgctgctgaggaaaatgcgattgttgttcctctttgcaaccaaatc
gaagctgaaatttcattattagaagatgaagaccgtgctgagttcctagaagcaatgggc
atggaagaaccaggtttaaatgtggttattcgtgcaggttatgcgcttttaggtttacag
acttatttcactgctggtgtacaagaagttcgtgcatggacagtaaaagttggcgcaacc
gctcctcaagccgctggtgtgattcataccgacttcgaaaaaggcttcatccgtgctgaa
gttgttgcatatgatgacttcgtacaatacaacggtgaaaacggcgctaaagaagctggt
aaatggcgtttagaaggtaaaacttacgttgttcaagacggcgatgtaatgcacttccgt
tttaacgtttaa

DBGET integrated database retrieval system