KEGG   Acinetobacter pittii: BDGL_000865Help
Entry
BDGL_000865       CDS       T01684                                 

Gene name
metI
Definition
(RefSeq) D-and L-methionine transport protein (ABC superfamily, membrane)
  KO
K02072  D-methionine transport system permease protein
Organism
acc  Acinetobacter pittii
Pathway
acc02010  ABC transporters
Module
acc_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:acc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BDGL_000865 (metI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acc02000]
    BDGL_000865 (metI)
Transporters [BR:acc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    BDGL_000865 (metI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 FtsX
Motif
Other DBs
NCBI-GeneID: 11639045
NCBI-ProteinID: YP_004995133
UniProt: F0KLN5
Position
complement(915962..916621)
Genome map
AA seq 219 aa AA seqDB search
MHDQLIDLLITGTVDTLLMVGASAFIAFLIGLPIAVVLVSTSEHGIHPSQKINQALGWVI
NITRSVPFLILMVALIPLTRWIVGTSYGVWAAVVPLTIAAIPFFARIAEVSLREVDQGLI
EAAQAMGCNRKQIIWHVLLPEALPGIVAGFTVTIVTMINSSAIAGAIGAGGLGDIAYRYG
YQRFDMQIMLAVILVLIVLVMLVQATGDALAQQLDKRKV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaccagctcattgacttattaattactggaactgtagacaccttactcatggta
ggtgcatctgcatttattgcttttttaattggcttaccgattgctgttgttttagtcagt
acttctgagcacggcattcatccgtcacaaaagattaatcaagctttgggttgggtcatc
aacattactcgctctgtaccctttcttattttaatggttgcacttattccgcttactcgc
tggattgtcgggacaagttatggggtttgggcagccgttgttccattgacgattgcggca
attcccttctttgcgcgtattgcagaagtcagcttacgcgaagtcgatcaaggcttaatt
gaagcagcacaagccatgggttgtaaccgtaaacaaattatctggcatgtacttttacca
gaggctttgccgggtattgtggcgggttttaccgtgactattgtgactatgattaactcc
tctgcgattgctggtgctattggtgcaggtggtctaggagacattgcttatcgttatggc
tatcaacgttttgatatgcaaattatgttggctgtaattttagtgctcattgttttagtc
atgttggtacaagcgactggcgatgcattagcccagcaacttgataaacgtaaagtttaa

DBGET integrated database retrieval system