KEGG   Acinetobacter pittii: BDGL_000866Help
Entry
BDGL_000866       CDS       T01684                                 

Gene name
metN1
Definition
(RefSeq) D-methionine ABC transporter ATP-binding protein
  KO
K02071  D-methionine transport system ATP-binding protein
Organism
acc  Acinetobacter pittii
Pathway
acc02010  ABC transporters
Module
acc_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:acc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BDGL_000866 (metN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acc02000]
    BDGL_000866 (metN1)
Transporters [BR:acc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    BDGL_000866 (metN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N NIL AAA_21 RsgA_GTPase AAA_22 AAA_16 MMR_HSR1 Herpes_Helicase AAA_29 SbcCD_C AAA_23 PRK
Motif
Other DBs
NCBI-GeneID: 11639046
NCBI-ProteinID: YP_004995134
UniProt: F0KLN6
Position
complement(916602..917678)
Genome map
AA seq 358 aa AA seqDB search
MTMVSFGSQVDFSLPHIKIRGLNKFYQSQGQKLHALKEINLDVPQGKILGIIGKSGAGKS
SLLRTLNGLEQVNTGSIHIHQQNIAELSHAELIQTRQRIGMIFQHFNLMSAKTVWENVAL
PLKVSNYNKADIDQRVNEVLALVGLADKSGYYPSQLSGGQKQRVGIARALVHHPEILLCD
EATSALDPESTATILALLKKINQELGLTIVLITHEMQVIREICDQVVVIDQGEIVEAGQV
WSVFSRPEQQITQELLNLEQITLPFKISPLPDENSTHIIVKLKYEAEAHQVPDIQELLAR
FKAPVNLYQSQVDTIQGHIIGSLLVGIPNVEIDISSIRQDALTAIAQFEVLGYARPAH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacgatggtgagttttggatcgcaagttgatttttctctaccccatatcaaaattcgt
ggtttaaataagttttaccaatcgcagggtcaaaaactgcatgcgttaaaggaaattaac
cttgatgttccccaaggtaaaatcttaggcattattggtaaaagtggtgcaggcaaatct
tccttgctccgtactttaaatggcttagaacaggtaaatactggcagtattcatattcat
caacaaaacattgctgaattgagtcatgccgagcttattcaaactcgccagcgaattgga
atgatttttcaacatttcaatttaatgtctgcaaaaacagtctgggaaaatgtggcattg
cctttaaaagtttccaattacaacaaagcagatatcgaccaacgtgtaaatgaagttttg
gcactcgtaggtcttgcagataagtctggctactatccatcgcaactttcgggcggacaa
aagcaacgtgtcggtattgcacgtgcacttgttcaccacccagaaattttactttgtgat
gaagcaacctcggcacttgaccctgaaagtaccgccactattttggctttacttaaaaag
attaatcaggaactgggtctaacgattgtactcatcactcacgaaatgcaggtcattcga
gaaatttgtgatcaagtggtagtgattgatcaaggtgagatagtagaagctggacaagtt
tggtctgtattttcacgaccagaacaacaaattactcaagaattgttaaaccttgagcaa
attaccctaccttttaaaataagtcctctacccgatgaaaattcgacgcatattattgta
aaactgaaatatgaggctgaagcacatcaggttcccgatattcaagaactacttgccaga
tttaaagcacctgtcaatttatatcaaagtcaggtcgataccattcaagggcatattatt
ggttcacttttagtcggtattcctaacgtagaaattgatatttcatctatacgacaagac
gcattaactgcaattgcacaatttgaggtacttggctatgcacgaccagctcattga

DBGET integrated database retrieval system