KEGG   Acinetobacter pittii: BDGL_000869Help
Entry
BDGL_000869       CDS       T01684                                 

Gene name
soxA
Definition
(RefSeq) alkanesulfonate monooxygenase
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase
Motif
Other DBs
NCBI-GeneID: 11639049
NCBI-ProteinID: YP_004995137
UniProt: F0KLN9
Position
complement(919376..920788)
Genome map
AA seq 470 aa AA seqDB search
MADFKAKEILLNAFDMNCVGHINHGLWTHPRDESHRFNELSYWTEQAKTLESGLFDGLFI
ADITGVYDVYQNGIDLTLKESIQLPSHDPSTLISAMAAVTQNLSFGVTVNLSYEHPYQFA
RRFASLDHLTQGRIGWNIVTGYLDSAERLIGQKGLKDHDARYEQAEEFLELCYKYWEGSW
ENDAVKKDKARRVFTDPSKVHTIHHHGKYYQSEGVFQVSPSIQRTPTLFQAGASPKGMQF
ATRHAECVFIGGDKPEKIREQVKKIRALAEQQGRSADDIKVFVGITVVVAETHDLAVQKL
NEYRQYASPEAGLAHYASSTGIDLSKFADDEAIPYQKSNSIVSITEKFKEQQITKNDLKA
QHVLGGRYPLIVGSGEEVAEYLIHLLDETDIDGFNLTRTVAPESHHDFIRLVIPELQQRG
RYKTAYKKGSLRNKIFNRGDQLPKQHPVQAFRCSPYNNSKNLTTIEEITA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcagatttcaaagcgaaagaaattttactcaatgcctttgacatgaactgtgttggt
catatcaatcatggcttatggacacatccacgtgatgaatcacatcgttttaacgaactc
agttattggacagaacaagctaaaaccttagaaagtggtttatttgacggcttgtttata
gccgatattactggtgtgtatgacgtctatcaaaatggtattgatctcactttaaaagag
tccattcagcttccgagccatgacccgtctacactcatttcagcaatggcggcagtcact
caaaacttaagttttggggtcactgtgaacttaagctatgagcatccgtatcaatttgcc
cgccgctttgcgagtctcgaccatttaactcaaggtcgtattggctggaatatcgtgaca
ggttatctagatagtgcggaacgcttaattggtcaaaaaggtttaaaagaccacgatgct
cgctatgaacaagctgaagaatttttagagctttgctataaatattgggaaggttcatgg
gaaaacgacgccgttaaaaaagataaagcacgacgtgtttttacagacccgtctaaagtt
cacaccattcatcatcacggcaaatattaccaaagcgaaggcgtgtttcaggtatctcct
tctatacaacgcactccaacactgttccaagcaggtgcttcacccaaaggtatgcagttc
gctactcgtcatgctgagtgtgtatttattggcggcgacaaacccgaaaaaatacgagaa
caagtgaaaaagattcgtgctcttgcagaacagcaaggccgttcagcggatgacattaaa
gtcttcgttggcatcaccgttgttgttgccgaaacacatgatctcgcagtacaaaaactt
aatgaatatcgtcagtatgcgagccctgaagcaggcttagcgcattatgcgagttcaaca
ggcattgacttaagtaagtttgctgacgatgaagcaattccttaccaaaaaagtaacagc
attgtttcgattaccgaaaagtttaaagagcaacaaatcacgaaaaatgacttaaaagct
cagcatgttttaggtggtcgttatccactcattgtgggtagtggcgaagaagttgctgaa
tacttaattcatcttttagatgagacagatattgatggctttaatttaacacgtactgtt
gcacctgagtctcaccacgactttatccgcttggtcattcctgagctacaacaacgtggt
cgctataaaactgcatataaaaagggttcactgcggaacaaaatttttaatcggggtgat
caattaccaaaacaacaccctgttcaagcgttccgatgtagtccctataacaacagcaaa
aacttaacaacaattgaagaaataaccgcttaa

DBGET integrated database retrieval system