KEGG   Acinetobacter pittii: BDGL_000872Help
Entry
BDGL_000872       CDS       T01684                                 

Definition
(RefSeq) glutathione S-transferase, N-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acc  Acinetobacter pittii
Pathway
acc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BDGL_000872
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acc02000]
    BDGL_000872
Enzymes [BR:acc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BDGL_000872
Transporters [BR:acc02000]
 Other Transporters
  Pores ion channels [TC:1]
   BDGL_000872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_3 GST_N_2 GST_C GST_C_2 GST_N GST_C_6
Motif
Other DBs
NCBI-GeneID: 11639052
NCBI-ProteinID: YP_004995140
UniProt: F0KLP2
Position
923629..924369
Genome map
AA seq 246 aa AA seqDB search
MSHYCEKARWLLDHKELDYVAHNLIPGFHRAFAQLKTGQNLLPILKDDHQWIAESTKIAL
YLDDTYPEHSLLRRDEQLRQQTLKIDSLADELGIHVRRWALAHTLAQGDHALEIMMGEQG
YLRQFEKISKPFLKTLVKKNYKLEEELVNQSKERMDELINELNNCLIENQARYMVGDRLS
LADISVCSMLAPLLEIKGTPWEREEAEGVSEEWNNYQQNLLDLPLGQYVLRIYQTERNAR
VDWRGI
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccattattgtgaaaaagctcgctggttgttagaccataaagaacttgattatgtg
gctcataacttaattccaggctttcatcgtgcttttgcacaactcaaaacaggccaaaat
ttactgcctattttgaaagatgatcatcaatggatcgctgaatcgactaaaattgcactt
tatctggatgatacttatccggagcattcactgttacgtcgtgatgaacaattaagacag
caaacattaaaaatagatagcttggctgatgagctgggtattcatgtccgtcgttgggct
ctagctcatacgttggcgcaaggagaccatgctttagaaattatgatgggtgaacaaggc
tatttacgccaatttgaaaaaatatcgaagccattcctcaaaacactggtaaagaagaac
tataaacttgaagaagagctagtcaaccagtcaaaagaacgtatggatgaactcataaat
gaactaaataactgcttaatcgaaaatcaggcacgttatatggtaggcgatcgcttaagt
cttgctgatatttctgtatgttctatgcttgctcctttattagaaataaagggtacgccg
tgggagagggaagaggctgaaggtgtttcggaagaatggaataactatcaacaaaattta
ctcgatttacctctaggtcagtatgttttaagaatatatcaaactgagcgtaatgcgcga
gtagattggcgcggaatttaa

DBGET integrated database retrieval system