KEGG   Acinetobacter pittii: BDGL_000873Help
Entry
BDGL_000873       CDS       T01684                                 

Gene name
gltI
Definition
(RefSeq) glutamate/aspartate transport protein (ABC superfamily, peri_bind)
  KO
K10001  glutamate/aspartate transport system substrate-binding protein
Organism
acc  Acinetobacter pittii
Pathway
acc02010  ABC transporters
acc02020  Two-component system
Module
acc_M00230  Glutamate/aspartate transport system
Brite
KEGG Orthology (KO) [BR:acc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BDGL_000873 (gltI)
  09132 Signal transduction
   02020 Two-component system
    BDGL_000873 (gltI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acc02000]
    BDGL_000873 (gltI)
Transporters [BR:acc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter [MD:M00230] [OT]
    BDGL_000873 (gltI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Phosphonate-bd NMT1 Lig_chan-Glu_bd
Motif
Other DBs
NCBI-GeneID: 11639053
NCBI-ProteinID: YP_004995141
UniProt: F0KLP3
Position
924902..925795
Genome map
AA seq 297 aa AA seqDB search
MKRSATSLIISTVMLCTVGATSQIQAADTLAKIKSTGKIVIGHRESSDPISYVVAGKPVG
YAVDICNQFANDIKKELKMPGLKVEYKAVTSSTRIPELLAGNIDMECGTTTNSKQRQQQV
GFSTNYYATEVRMAVKANSGIKSLADLNGKAVVTTQGTTSDKYIKMNEKGQAVNVQNIYG
KDHADSFAMMASGRAAAFVMDDNILAGLIAKSSTPKAFAIVGPVLSSEPYGIMLAKDDPK
FKAIADRTVNNLWKTGKMDALYKKWFLSPIPPKNTNLNMQQSSSYKKLKANPTDAGI
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttctgcaacctctctcattatttcaacagttatgctttgtacggttggcgct
acttctcaaattcaagcagcagatacattagctaaaattaaaagtaccggaaaaatcgta
attggtcatcgagaatcctcagatccaatttcatatgttgttgcaggtaaaccagtaggt
tatgcagtcgatatctgtaaccagtttgcaaatgacattaaaaaagaattgaaaatgcct
ggcttaaaagttgagtacaaggcagtaacttcatcaacacgtattcctgagcttttagca
ggcaatatcgatatggaatgtggtaccactacaaactctaaacaacgtcagcaacaagtt
ggtttctcaactaactactatgcaacagaagtgcgcatggctgttaaagcaaactctggc
attaagagtttggcggacttaaatggtaaagcagttgttactactcaaggcactacatct
gacaaatacatcaagatgaatgaaaaaggtcaggcagttaatgttcaaaatatttatggt
aaagatcatgctgactcttttgccatgatggcatctggccgtgctgctgcatttgtaatg
gatgataatattttagcaggcttgattgctaagtcttctacacctaaagctttcgcaatt
gtaggtccggtactttcatctgaaccttacggaattatgctcgctaaagatgatccaaaa
tttaaagcgattgcagaccgtactgtaaataacttgtggaaaactggtaaaatggacgct
ttatataagaagtggttcttatctccaattccaccaaaaaacacgaatttgaacatgcaa
caaagttcatcttataagaaattaaaagctaacccaacagatgcaggaatctaa

DBGET integrated database retrieval system