KEGG   Acinetobacter pittii: BDGL_000874Help
Entry
BDGL_000874       CDS       T01684                                 

Gene name
gltJ
Definition
(RefSeq) glutamate/aspartate transport protein (ABC superfamily, membrane)
  KO
K10003  glutamate/aspartate transport system permease protein
Organism
acc  Acinetobacter pittii
Pathway
acc02010  ABC transporters
acc02020  Two-component system
Module
acc_M00230  Glutamate/aspartate transport system
Brite
KEGG Orthology (KO) [BR:acc00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BDGL_000874 (gltJ)
  Signal transduction
   02020 Two-component system
    BDGL_000874 (gltJ)
Transporters [BR:acc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter [MD:M00230] [OT]
    BDGL_000874 (gltJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Phtf-FEM1B_bdg
Motif
Other DBs
NCBI-GeneID: 11639054
NCBI-ProteinID: YP_004995142
UniProt: F0KLP4
Position
925890..926732
Genome map
AA seq 280 aa AA seqDB search
MSVGSLNWTIFCAESNEYGVDKAAWAESVCKAIGSSSYNAYAEAPTWLQMLGSGVFTMVW
TAIIAFLIAFLLGSLLGVIRTLPNKPLAFIGNCYVEIFRNIPLIVQLFFWAFVFPEFLPD
SLSAGSGDVVAGGWWKNILNQQPAVIGVFALGLYTAARVSEHIRAGINTVSRGQKFAASA
MGFTTAQSYRYVILPVAYRTVWPTITSEAMNVFKNSAVLYALSVLNFFAYTKTMREETSQ
DIIILILSTPVYLIITYSIKFVMAWIEKRMAVPGLGSGGK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcggctcgctaaactggactatattctgtgcggagtctaatgaatatggtgtc
gataaagccgcatgggcagaatcagtttgtaaagctattggtagctcaagctacaatgct
tatgctgaggcacccacatggttacaaatgttaggttcaggcgtgttcactatggtttgg
acagctattatagcctttcttatcgcatttttattaggttctctcctaggggtaattcgt
acattacccaacaaacctctcgcatttatcggcaattgttacgttgaaattttccgtaat
attccacttattgtgcaactattcttttgggcttttgtttttcccgagtttttaccggac
agcttaagtgcaggtagtggggatgtagttgctggtggttggtggaaaaatattttaaat
cagcaacctgcggttattggtgtttttgcattaggtctctacacggctgcccgtgtatct
gagcacatacgtgccggaattaataccgtttctcgtggacagaagttcgcagcttccgct
atgggttttactactgcacaaagctatcgttatgtcattttaccggttgcatatcgtacc
gtatggccaacgattacatctgaagcaatgaacgtttttaaaaactcagctgttttatat
gcgttgagtgtgttgaatttctttgcttacacgaaaaccatgcgtgaagaaacttctcag
gacattatcattcttattctctccacacctgtttatttgattatcacttatagcattaag
tttgtgatggcatggattgagaaacgaatggctgtacctggcttaggttcaggagggaag
taa

DBGET integrated database retrieval system