KEGG   Acinetobacter pittii: BDGL_000879Help
Entry
BDGL_000879       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transcrip_reg TraE
Motif
Other DBs
NCBI-GeneID: 11639059
NCBI-ProteinID: YP_004995147
UniProt: F0KLP9
Position
complement(930394..931143)
Genome map
AA seq 249 aa AA seqDB search
MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAAKLGGGDPASNPRLRAVVEKALSVN
MTRDTINRAIQRGAGGEDNDDLKEVTYEGYGVGGVAVLVETMTDNLNRTVPDVRHCFSKT
NGNLGTAGSVSYLFTKRGEITFEDVSLEDKIMEVALEAGAEDIEVSEDEILVITSPETFG
EVQDALTAAGLKSDNAEVVMSPSTKAEITDVDQAKQILKMIDMFEDLDDVQNVYTNVEFS
DEVLAQLDA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtcattctaaatgggccaatattaagcatcgtaaagctaaacaagatgcaagt
cgcggtaaggtttttactaaatatattcgtgaaattgtgactgctgccaaacttggtggt
ggagatcctgctagcaaccctcgtctgcgtgcagtagttgaaaaagctctctcagttaat
atgacacgtgacaccattaaccgtgctatccaacgtggtgctggtggtgaagataatgat
gatctaaaagaagtaacttatgaaggttatggtgttggcggggttgctgttcttgttgaa
acaatgacagataacttaaaccgtacagtaccagacgtacgtcactgttttagtaaaaca
aatggtaacttaggaactgcgggttctgtatcttatctatttactaaacgtggtgagatt
acttttgaagatgtttctttagaagataaaatcatggaagttgctttagaagctggcgct
gaagatattgaagtttcagaagatgaaattttggtaatcacttcaccagaaactttcggt
gaagtgcaagacgcccttactgctgctggtttaaaatctgataacgcagaagttgtgatg
agcccatctacaaaagctgaaattacagatgttgaccaagcaaaacaaattcttaaaatg
attgatatgtttgaagatcttgacgatgtacaaaacgtttatactaacgttgaattctcg
gatgaggttttggctcaacttgatgcttaa

DBGET integrated database retrieval system