KEGG   Acinetobacter pittii: BDGL_000881Help
Entry
BDGL_000881       CDS       T01684                                 

Definition
(RefSeq) putative acyltransferase
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-GeneID: 11639061
NCBI-ProteinID: YP_004995149
UniProt: F0KLQ1
Position
complement(931594..931839)
Genome map
AA seq 81 aa AA seqDB search
MKKFLGNSIFKAVGWTYNVDPQILEKKQVIIGFEHTSNLDAVLSIALFQMLDIKIHTLIK
KELFKGPLKPILEKLGGIPVE
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttctaggtaactctatctttaaagccgttggttggacctacaatgtagac
ccacaaattcttgagaaaaaacaagttattattggctttgaacatacctcaaatctagat
gcagtgctctcgattgccctcttccaaatgttagacatcaaaattcatactctaataaag
aaagaacttttcaaaggcccacttaagccaattttagaaaaattgggtggcattcctgtt
gagtaa

DBGET integrated database retrieval system