KEGG   Acinetobacter pittii: BDGL_000883Help
Entry
BDGL_000883       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Haem_oxygenas_2 TENA_THI-4
Motif
Other DBs
NCBI-GeneID: 11639063
NCBI-ProteinID: YP_004995151
UniProt: F0KLQ3
Position
932865..933740
Genome map
AA seq 291 aa AA seqDB search
MRADMPKKFENFNNPRKKALTGMKQSISAELWEKNSNFLTRLRAKIAKHPVSHHPAIDTL
NNGEINKEDLIKIHLEYRHAIVQTFTDALLMAQFQTKQLEPRLHAGAKMFPRFLLSLNIF
DEFGFRPGLDKDGYYQGNPEYAHYPLFEDILNDFGITEQDRLTYHPTEIADQVRVFLENA
YNDYKAVSALLAVAEEEVILYSPPLRRATKAVGLDVEGGGYYHVHGISEDESAEAADDDH
EEDLWYVLMQACTEEDYNYIEKLCLEYCDLWEKFWDTQLENSEPMRKQILA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagagcggatatgcctaagaaatttgagaattttaataatcctagaaagaaagcgctt
acagggatgaaacaaagcatttcagctgaactatgggaaaaaaattcaaactttttgacc
cgattaagagcaaagattgcaaaacatcctgtatctcatcatcctgcaatcgatacttta
aataatggcgaaattaataaagaagatttaataaaaattcatttagagtatcgtcatgca
attgtgcaaacttttactgatgcattgctcatggcccaatttcaaactaaacaattagag
ccgagattgcatgctggtgcaaaaatgttcccgcgttttcttttgagtttaaatattttt
gatgagtttggatttcggccagggttggataaagacggctactatcagggaaatcctgaa
tatgctcattatcccttatttgaagatatattgaatgatttcggtattacagaacaagat
cgtctaacttatcatccgactgaaattgcagatcaggttagggtatttttagaaaatgct
tataatgactataaagctgtttcagccttattagcagtcgcagaagaagaagtcattctg
tatagtccaccgttacgtagagcaactaaggcagttggtctagatgtggagggtggtggt
tattatcatgtacatggtatttctgaggatgaaagtgctgaagcagcagatgatgatcat
gaagaggatttatggtatgtcttgatgcaagcttgtacagaagaagactataattatatt
gaaaaattatgcttagagtattgtgatttatgggaaaagttttgggatacacaattagag
aattctgagcccatgcgaaagcaaatcttagcttaa

DBGET integrated database retrieval system