KEGG   Acinetobacter pittii: BDGL_000902Help
Entry
BDGL_000902       CDS       T01684                                 

Gene name
yncA
Definition
(RefSeq) putative antibiotic resistance (acetyltransferase) protein
  KO
K03823  phosphinothricin acetyltransferase [EC:2.3.1.183]
Organism
acc  Acinetobacter pittii
Pathway
acc00440  Phosphonate and phosphinate metabolism
acc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BDGL_000902 (yncA)
Enzymes [BR:acc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.183  phosphinothricin acetyltransferase
     BDGL_000902 (yncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_4 Acetyltransf_3 Acetyltransf_10 GNAT_acetyltran FR47 Acetyltransf_7 Acetyltransf_CG
Motif
Other DBs
NCBI-GeneID: 11639083
NCBI-ProteinID: YP_004995170
UniProt: F0KM77
Position
952875..953420
Genome map
AA seq 181 aa AA seqDB search
MIKNLNSNLRLIDCHEATHAKAILDILNEAIINSTALYDYLPRSEESMKNWFAVKRENGF
PVIGIIDETNKLLGFASWGTFRAFPAYKYTVEHSIYIHHEHRGGGLSKILMQELIKRAQE
ADLHVLIGCIDATNQASIGLHEKMGFIHAGTFKQVGFKFGQWLDAAFYQLNLNTPHTPVD
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaatcttaattcaaatttacgtttaatcgattgtcatgaagctacacatgca
aaggctatattagatattttgaatgaagcaattatcaattctaccgctttgtatgactat
ttgccgcgctctgaagagtcaatgaaaaactggttcgcggttaaaagagaaaatggtttt
cctgtcattggtattattgatgaaacaaacaagttattaggttttgcaagttggggaact
tttagagcttttcctgcctataaatatactgttgaacatagtatttatattcatcatgaa
catcgtggcggcggattaagcaaaattttaatgcaagaattgattaagcgtgctcaagag
gcagacttacatgtattgataggctgtattgatgcaaccaatcaagcaagtattggtttg
catgaaaaaatgggctttattcatgcaggtacttttaagcaagtcggttttaagtttggc
caatggttagatgctgctttctatcagttaaatttaaatacaccgcataccccagttgat
ggataa

DBGET integrated database retrieval system