KEGG   Acinetobacter pittii: BDGL_000909Help
Entry
BDGL_000909       CDS       T01684                                 

Gene name
tktA
Definition
(RefSeq) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
acc  Acinetobacter pittii
Pathway
acc00030  Pentose phosphate pathway
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01120  Microbial metabolism in diverse environments
acc01130  Biosynthesis of antibiotics
acc01200  Carbon metabolism
acc01230  Biosynthesis of amino acids
Module
acc_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:acc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BDGL_000909 (tktA)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    BDGL_000909 (tktA)
Enzymes [BR:acc01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     BDGL_000909 (tktA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 11639090
NCBI-ProteinID: YP_004995177
UniProt: F0KM84
Position
957879..959858
Genome map
AA seq 659 aa AA seqDB search
MTTPLNERRIANAIRVLAMDAVQQANSGHPGAPMGMADIADVVWREFLNHNPTNPQWANR
DRFVLSNGHGSMLQYALLHLTGYDLSIEDLKQFRQLHSRTPGHPEYGYAPGVETTTGPLG
QGIANAVGFALAEKTLAAQFNKDDLKVVDHFTYCFLGDGCLMEGISHEVCSLAGTLQLGK
LIAYYDDNGISIDGEVEGWFSDDTEERFKAYGWQVLRVDGHDADAIRQATIEAKAETQKP
TIIMCKTIIGLGSPNKQGKEDCHGAPLGKDEITLTREALGWNEVIPADVYAAWDAKAKGS
ESEAAWNAVFAQYQAKYPTEAAELLRRISGDLPAEFAAQADAFIRETNAKGETIATRKAS
QNTLQAFGPLLPELLGGSADLAGSNLTLWKGCQGVQENPAGNYVYYGVREFGMTAIANGV
ALHGGFVPYVATFLMFMEYARNAVRMSALMKQRVIHVYTHDSIGLGEDGPTHQPIEQIAS
LRGTPNLNTWRPADTVETAIAWKSALERKDGPTALIFSRQNLPFQTRSEEQIQNAAKGGY
VLAQEKGELKAIIIATGSEISLAMEAYAQLEGVRVVSMPCAEEFMKQDAAYREAVLPAHI
RARVAVEAAHVDYWWKFVGLDGKVIGMTTYGESAPAKDLFQFFGITTEAVVAAVKELTA
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccctttaaacgaacgtcgtattgcaaatgcaattcgtgtattggcaatggat
gctgtgcaacaagcaaactcagggcatccaggtgctccaatggggatggcagatattgct
gacgtcgtctggcgtgagtttttaaatcacaacccaacaaatccacaatgggcaaaccgt
gaccgtttcgttttatcaaatggccatggctcaatgttgcaatacgctttgcttcattta
acaggttatgatctttcaattgaagatttaaaacagttccgtcaattgcattctagaact
cctggtcatcctgaatatggctatgcaccgggtgtagagacgacaactggtcctttaggt
caaggtattgctaatgctgttggttttgctttagcagaaaaaacattggctgctcaattt
aataaagatgatttaaaagttgttgaccatttcacttactgtttcttaggtgatggctgt
ttaatggaaggtatttctcatgaagtatgttctttagctggcaccttacaacttggtaaa
ttgattgcttattatgatgataatggcatttcaattgatggtgaagtagaaggctggttc
agcgacgatacagaagagcgtttcaaagcctatggttggcaagttcttcgtgtagatggt
catgatgctgatgcgattcgtcaagcgacaatcgaagcaaaagctgaaactcagaaacca
acaatcattatgtgtaaaacgattattggtttaggttcaccgaataagcagggtaaagaa
gactgtcatggtgcgccattaggtaaagatgaaattactttaactcgtgaagcattaggc
tggaacgaagttattcctgctgatgtatatgctgcatgggatgcaaaagcaaaaggtagt
gaatctgaagcagcttggaatgcggtatttgcacaatatcaagcaaaatatccaactgaa
gcggctgagttacttcgtcgtatcagtggtgacttaccagcagaatttgcagcgcaagca
gatgctttcattcgtgaaacaaatgcgaaaggcgagacaattgcaactcgtaaagcaagc
caaaatacattacaagcatttggtcctttattacctgaattgttaggtggttctgctgac
ttagcaggttctaacttaacactttggaaaggttgccaaggtgttcaagaaaacccagct
ggtaactatgtctactatggcgtacgtgaattcggtatgactgcgatcgctaatggcgtt
gcattacatggcggttttgttccttacgttgcaacattcttaatgtttatggaatatgca
cgtaatgcagtacgtatgtctgcattaatgaaacaacgtgtaattcatgtttatacacat
gactcaatcggtctgggtgaagatggtccaactcatcaaccgattgaacaaattgcttca
ttacgtggtacacctaacttaaatacatggcgccctgcggatactgtagaaactgcaatt
gcttggaaatctgctttagaacgcaaagatggccctacagcacttattttctctcgtcaa
aacttaccattccaaacacgttctgaagagcaaattcaaaacgctgcaaaaggcggttat
gtacttgctcaagaaaaaggcgaattaaaagcgattattattgcaactggttcagaaatt
tctttagcaatggaagcttatgcacaacttgaaggtgtgcgtgtagtttctatgccatgt
gcagaagaatttatgaagcaagatgccgcataccgtgaagcagtattgccagctcatatc
cgtgcgcgtgttgctgttgaagcagctcatgttgattactggtggaaatttgttggtctt
gatggcaaagtaattggtatgacaacttatggtgagtctgcaccagcaaaagatttgttc
caattctttggtattacgactgaagctgttgttgcagccgtaaaagaattaactgcttaa

DBGET integrated database retrieval system