KEGG   Acinetobacter pittii: BDGL_000915Help
Entry
BDGL_000915       CDS       T01684                                 

Gene name
trmA
Definition
(RefSeq) tRNA (uracil-5-)-methyltransferase
  KO
K00557  tRNA (uracil-5-)-methyltransferase [EC:2.1.1.35]
Organism
acc  Acinetobacter pittii
Brite
KEGG Orthology (KO) [BR:acc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acc03016]
    BDGL_000915 (trmA)
Enzymes [BR:acc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.35  tRNA (uracil54-C5)-methyltransferase
     BDGL_000915 (trmA)
Transfer RNA biogenesis [BR:acc03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    BDGL_000915 (trmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_U5-meth_tr Cons_hypoth95 Methyltransf_15 Methyltransf_25 Methyltransf_31 Methyltransf_4 DREV Met_10 Methyltransf_11 PrmA
Motif
Other DBs
NCBI-GeneID: 11639096
NCBI-ProteinID: YP_004995183
UniProt: F0KM90
Position
complement(963215..964300)
Genome map
AA seq 361 aa AA seqDB search
MTSSYRQQLQAKIERITTQFSEFTPPTLEVFESPEQHFRMRAEFRIWHTENDMFYAMFER
NDDDKQKTVVRIDEFPIADHSINDLMPKLLEELKAEPKLSNRLFEADFLATLSGEMLVTL
IYHRKLDQEWEQAAKALADKLDIKIMGRSRGQKIVIGDDFVVEEFELLNRSFKYKQIESS
FTQPNAQVCKKMLQWACDAAEGSKKHLLELYCGNGNFTLPLSLKFERVLATELAKSSVYA
AQWNIEQNQIDNIQVARLSAEEFTQAYQGEREFRRLQEANIDIQSYDFDTVFVDPPRAGI
DDETLKLLQGFERIIYISCNPDTLYENLKTLSQTHRVTKFALFDQFPYTHHVESGVLLEK
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacctcttcttatcgtcaacaacttcaagctaaaattgaacgtattactactcaattt
tctgaatttacaccacctacattagaagtgtttgaatcacctgaacaacatttccgtatg
cgtgctgaatttcgtatctggcatacagaaaatgatatgttctatgccatgtttgagcgt
aatgatgacgacaagcaaaaaaccgttgtacgcattgatgagtttccaattgcagatcat
agcatcaatgatttaatgccaaagctcttggaagaactcaaggctgagcctaagctctct
aaccgtttatttgaagctgatttcctcgcaacacttagcggagaaatgttggttacccta
atttatcaccgtaaactggatcaagaatgggaacaagcagctaaagcgcttgccgataaa
ttagatattaagattatgggccgtagtcgtggccagaaaattgttattggcgatgatttc
gtcgttgaagaattcgaacttttaaatcgttcatttaaatacaagcaaatcgaaagtagc
tttacccagcctaatgcacaggtttgcaaaaaaatgctgcaatgggcatgtgacgcagct
gaaggatcaaagaaacacttattagaactctattgtggtaatggtaattttacgcttccg
ctctctttaaagttcgaacgagtattggctaccgagcttgcaaaatcctctgtttatgca
gctcaatggaacattgaacaaaatcaaatcgataatattcaagtagcacgtctatcggct
gaagagtttactcaagcttatcaaggtgagcgcgaattccgccgactacaagaagcaaat
attgatattcagagttatgactttgacaccgtatttgtagatccaccacgtgcaggaatt
gatgatgaaactttaaaacttctacaaggttttgaacgtattatctacatttcatgtaat
cctgacacgttatatgaaaacttaaaaacgctcagtcaaactcatcgagtgactaaattt
gcgttatttgatcagttcccttatacgcatcatgtcgagtctggtgttttacttgagaag
atttaa

DBGET integrated database retrieval system