KEGG   Acinetobacter pittii: BDGL_000921Help
Entry
BDGL_000921       CDS       T01684                                 

Gene name
gcvH
Definition
(RefSeq) glycine cleavage complex protein H, carrier of aminomethyl moiety via covalently bound lipoyl cofactor
  KO
K02437  glycine cleavage system H protein
Organism
acc  Acinetobacter pittii
Pathway
acc00260  Glycine, serine and threonine metabolism
acc00630  Glyoxylate and dicarboxylate metabolism
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01130  Biosynthesis of antibiotics
acc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BDGL_000921 (gcvH)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDGL_000921 (gcvH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_H Biotin_lipoyl RnfC_N
Motif
Other DBs
NCBI-GeneID: 11639102
NCBI-ProteinID: YP_004995189
UniProt: F0KM96
Position
complement(972101..972475)
Genome map
AA seq 124 aa AA seqDB search
MNHPSELKYARTHEWVKIEGDLVITGITDHAQDELGDLVYVETPEVGSKVTAGEQAGVVE
SVKTASDIHAPVSGTVVEVNTDLEDDPDFVNDDPYGKGWIYKIKPDNIADVEKLLTNAEY
EAGL
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatccttcagaactgaagtatgcacgtacacatgagtgggtaaagattgagggt
gatcttgttattacagggattaccgatcatgcacaagatgaacttggcgatttggtttac
gttgaaactccggaagttgggagtaaagttactgctggcgaacaagctggtgtggttgaa
tcagtaaaaactgcttctgacatccatgctcctgtttcaggcactgtagtagaagtaaat
actgaccttgaagatgatcctgattttgtaaatgacgatccatatggaaaaggctggatt
tataaaatcaaaccagacaatattgcagatgttgaaaaacttttaacaaatgcagaatat
gaagctggcttataa

DBGET integrated database retrieval system