KEGG   Acinetobacter pittii: BDGL_000922Help
Entry
BDGL_000922       CDS       T01684                                 

Gene name
appY
Definition
(RefSeq) DNA-binding transcriptional activator
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arabinose_bd HTH_18 HTH_AraC HTH_Tnp_ISL3 HTH_17 SurA_N
Motif
Other DBs
NCBI-GeneID: 11639103
NCBI-ProteinID: YP_004995190
UniProt: F0KM97
Position
complement(972513..973538)
Genome map
AA seq 341 aa AA seqDB search
MKITSARQDQGIPGVYGLLLLDVVSRWGYNDETLFAPFHLTSEQLADPDYRISTPVANEL
VKHALNLTGETTLGYHLGTQMRISIHGFIGYAIMTAKDITEAIALAARFIQLRLPFLQLY
FSTFGPKATLQLQCDIELEPLRTEIVLGLTIGIMSMAKAITGIEDLAGDVDLDFPEPEGF
EKYRNKLSSTIRFNQPHLISSFDKKYLGIKLVNADPIASQVAINQCEAELSALGERRRLA
MRVRDILSNSEQHYLSIENVAECLHMSDRTLKRQLAAEGTSFSTLVDEVRYRHATSLLSR
TDYSLEQIADELGYSDVANFSRAFKRWSGRSPSNWRKDPYL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattacctcagctcgtcaagatcaaggtattccgggagtctatggcttattgcta
ttagatgttgtttcgcgttggggatataacgatgaaacattatttgctccatttcatctt
actagtgagcaactggccgatcctgattatcgtatttctacacctgtagcaaacgaacta
gttaaacacgcgcttaatttaactggtgaaaccacgttgggttaccatcttggtactcaa
atgcgtatttcgattcatggcttcattggctatgcaattatgacagccaaagatattaca
gaagcaattgcccttgcagcacgctttattcaactacgtctaccttttttacaactttat
ttttcaacgtttgggccaaaagctaccctacaattacagtgtgacatcgaacttgaacct
ctaagaacagaaatcgttttaggtttgaccattggtattatgagtatggccaaggcaatt
acgggtatcgaagatttagctggtgatgtagatttggactttcctgaaccagaaggtttt
gaaaagtatagaaataaactaagcagcacaattcgcttcaaccagccacatttgatttca
agttttgataaaaaatacttaggaattaaattagttaatgctgatcctatcgcaagtcag
gttgctattaatcagtgcgaagccgaactttccgctttaggtgagcgccgtcgcttagca
atgcgagttcgtgatattttaagtaattctgaacaacattatttaagcattgaaaatgta
gctgaatgtctacacatgtcagaccgcacgctaaagcgccaattagcggctgaaggaact
tcattttctacattggttgatgaagtgcgctatcgacacgcaacatctctactttcacgt
acagattacagtcttgaacaaattgcagatgaacttggctattcagacgttgcaaatttt
agccgtgcttttaaacgctggagtggccgcagcccaagcaactggcgtaaagacccatac
ttataa

DBGET integrated database retrieval system