KEGG   Acinetobacter pittii: BDGL_000924Help
Entry
BDGL_000924       CDS       T01684                                 

Definition
(RefSeq) putative transport protein
  KO
K18893  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
acc  Acinetobacter pittii
Pathway
acc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:acc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BDGL_000924
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acc02000]
    BDGL_000924
Transporters [BR:acc02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    BDGL_000924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N MMR_HSR1 AAA_22 RsgA_GTPase AAA_16 AAA_29 AAA_21 AAA_7 DUF87 NTPase_1 AAA_15 DEAD AAA_18
Motif
Other DBs
NCBI-GeneID: 11639105
NCBI-ProteinID: YP_004995192
UniProt: F0KM99
Position
complement(974087..975934)
Genome map
AA seq 615 aa AA seqDB search
MLKWFEKLVDPYPTKGLDEPLPTRFFPFVWQATEGLRPYLFLLILFTAGAASFEALLFSK
IGQLVDWLSKSHPESFLSQHATDLLILIAVLFTNIFFVNIQSIIKHQILYSTFPMRLRWR
FHNLLLKQSLDFFHNDFAGRLSAKVMQTALAIREFWIILGDMLAYVSIYFITVSIVLGAI
SPILLIPLLVWLSLFLLSAWFFIPRLSKVSQQQADARAIMTGRVTDAYTNIQTVKLFAHA
GRESQYAKASMKEFMTTVYAQMRLGTLFEVSINMLSAVLFVGVIGTSVWLWTQGLAALGV
IAATTAMILKLNSMAEFMMWHMSALFENVGTIQDGMQTLGKKINIQDKPDAKPLAVTKGE
IVFKDVSFAYNNKNVIDHFNLHIRAGEKIGIVGRSGAGKSTLIQLLLHFYHLKQGAILID
GQNIEDVTQDSLRANIALVTQDTSLLHRSVAENIKYGRPDASDADMENAVNKAKAAEFIP
QLVDLKGRSGYNAQVGERGVKLSGGQRQRIAIARVFLKDAPILILDEATSALDSEVEAAI
QSSLNDLMVDKTVIAIAHRLSTIAQMDRLIVLDEGRIAEQGTHEELIAQNGIYAQLWKRQ
TGGFLIEQKVLQGQD
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagtggtttgaaaaacttgtagatccctacccaactaaaggtttagatgaacct
ttaccgactcgtttttttccatttgtgtggcaagctacggaaggcctacgcccttactta
ttcttacttattctttttacagcaggtgctgcaagctttgaagccttacttttttcaaag
attggacaactcgtagactggttaagtaaaagtcatccggaaagctttttaagtcagcat
gctactgatttactcattttgattgcagtcttatttaccaatatcttttttgtaaatatt
caatctattatcaaacatcagattttatatagtaccttcccaatgcgtttgcgctggcgt
ttccataatcttttattgaaacaaagcttggactttttccataatgactttgcaggacga
ctttctgctaaggttatgcaaacagcgttagcaatccgtgagttctggattattttgggt
gacatgttggcatacgtcagcatttacttcattacagtcagcattgttcttggcgcaatt
tcaccaattttacttattccacttttagtttggttaagcctatttttattaagcgcatgg
ttctttatcccccgcttaagtaaagtttctcagcaacaagccgatgctagagcgatcatg
actggccgtgtaacagatgcatacaccaacatccaaacagtaaaactatttgcccatgct
ggtcgtgaaagccaatacgcaaaagcatctatgaaagagtttatgactacagtctatgct
caaatgcgtttaggcaccctctttgaagtcagcatcaatatgttgtctgctgttttgttt
gtaggtgtaattggtacttctgtttggctatggacccaaggtttagcagcattaggtgta
atcgcagcaactactgcaatgattttaaaacttaatagtatggctgaatttatgatgtgg
catatgtcagccttatttgaaaatgttggaaccattcaagatggtatgcaaacattaggt
aaaaaaatcaatattcaagacaaaccagatgcgaaaccacttgcagtgaccaaaggtgaa
attgtatttaaagatgtaagctttgcttataacaataaaaatgtgattgatcacttcaac
ttgcatattagagcaggcgaaaaaataggaatcgtgggccgttctggcgcaggaaagtcg
acgctgatccagttgcttttacatttttaccatcttaagcaaggtgccattttaattgat
ggtcaaaacatcgaagatgtaactcaagatagtttaagagctaatattgctttagttact
caagatacgtctttattgcatcgctcagttgcagaaaatattaaatatggtcgccctgat
gcatctgatgcagacatggagaatgctgtaaataaagccaaagctgctgaatttattccg
caattggttgatttaaaaggacgtagtggttataacgctcaagtaggtgaacgtggtgtt
aaactttctggtggtcaaagacagcgtattgccattgcacgtgtattcttaaaagatgct
cctattcttattttagatgaagcaactagtgcattagactcggaagttgaagcagcaatc
cagtcaagtttaaatgacctgatggttgataaaaccgttattgcaattgcacaccgttta
tctactattgcacaaatggaccgtttaatcgttcttgatgaaggtcgaattgctgagcaa
ggaactcatgaagagttaattgcgcaaaatggtatatacgcacagttatggaaacgtcaa
acaggtggtttcctaattgaacaaaaagtattacagggtcaagattaa

DBGET integrated database retrieval system