KEGG   Acinetobacter pittii: BDGL_000948Help
Entry
BDGL_000948       CDS       T01684                                 

Gene name
holB
Definition
(RefSeq) DNA polymerase III subunit delta'
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
acc  Acinetobacter pittii
Pathway
acc00230  Purine metabolism
acc00240  Pyrimidine metabolism
acc01100  Metabolic pathways
acc03030  DNA replication
acc03430  Mismatch repair
acc03440  Homologous recombination
Module
acc_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:acc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BDGL_000948 (holB)
   00240 Pyrimidine metabolism
    BDGL_000948 (holB)
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BDGL_000948 (holB)
   03430 Mismatch repair
    BDGL_000948 (holB)
   03440 Homologous recombination
    BDGL_000948 (holB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acc03032]
    BDGL_000948 (holB)
   03400 DNA repair and recombination proteins [BR:acc03400]
    BDGL_000948 (holB)
Enzymes [BR:acc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BDGL_000948 (holB)
DNA replication proteins [BR:acc03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BDGL_000948 (holB)
DNA repair and recombination proteins [BR:acc03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     BDGL_000948 (holB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta2 AAA
Motif
Other DBs
NCBI-GeneID: 11639129
NCBI-ProteinID: YP_004995216
UniProt: F0KMC3
Position
998601..999581
Genome map
AA seq 326 aa AA seqDB search
MNPNVTSKVYPWQQTTWDTLTTRFPNIGHGLLFYGKQGCGKHAFAKQFLAWVLCLNKQPQ
GPCGECSSCQWLKSDTHPNYVHITTDEENKKQNAKIKIEKIRDLLPFVQQTGEGWRVIVI
EPAEALNLASSNALLKTLEEPGERVVLLLLADHYLKLPATIRSRLQHFALDRISYEQATS
YLNEHLSELAEVQPDLLLGLSNDMPLQAIEIAQSDWFAKRQVFLNDWLKIVAQKNMPLFF
SGKWQKELSFNDFIMLFEYLLGDLICVKLNQPQKNTDLDFDQLSPYYDLESLFNIYSELQ
QAKKLVEQNVQSQLIIDQLFITLMNI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgaatgtaacttcaaaggtttatccttggcagcaaacaacatgggacaccttg
acaacaaggtttcccaatattggacatggtctcttattttacggcaagcaaggttgtgga
aaacatgcttttgctaagcagtttttggcatgggtactttgtttaaataagcagccgcag
ggcccttgtggtgaatgtagtagttgccaatggttaaaatcagacactcatcccaattat
gttcatatcacaacggatgaagaaaataaaaaacagaatgcaaaaattaaaatagaaaag
atccgtgacttactacctttcgtacaacaaacgggagaaggttggcgcgttattgtgatt
gagcctgcagaagcacttaatttggcatcttcaaatgctttgctaaagactttagaagaa
ccaggcgagcgtgttgttttacttttattagctgatcactatcttaaactaccggccact
attcgtagccgattgcaacatttcgctttagatcgtatttcatatgaacaagctacttct
tatttgaatgagcatttatctgaacttgcggaagtgcagcctgatttactgcttggctta
tctaatgatatgcctttacaagcaatagaaattgctcaaagtgactggtttgcgaaaagg
caagttttcttaaatgattggcttaaaattgttgctcaaaaaaatatgcctttatttttc
tcaggcaaatggcaaaaagaattaagttttaatgattttataatgctttttgaatacttg
ttgggtgatttaatttgtgtcaagctaaaccaaccacagaaaaatactgatttagatttt
gatcagttaagcccatattatgatttagaaagcttatttaatatttatagtgaattacag
caagcaaaaaagcttgttgaacaaaatgtacaaagccaacttattattgatcaattattt
ataacgttaatgaatatttaa

DBGET integrated database retrieval system